Glyma15g05863 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g05863

Feature Type:	gene_model
Chromosome:	Gm15
Start:	4170378
stop:	4171110
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g05863

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G06330	AT	Annotation by Michelle Graham. TAIR10: Heavy metal transport/detoxification superfamily protein \| chr1:1931671-1932266 REVERSE LENGTH=159	SoyBase	E_val: 3.00E-11	ISS
GO:0006825	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transport	SoyBase	N/A	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
KOG1603	KOG	Copper chaperone	JGI		ISS
UniRef100_B9R8T1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Copper transport protein atox1, putative n=1 Tax=Ricinus communis RepID=B9R8T1_RICCO	SoyBase	E_val: 3.00E-41	ISS
UniRef100_UPI000233B5EB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B5EB related cluster n=1 Tax=unknown RepID=UPI000233B5EB	SoyBase	E_val: 1.00E-58	ISS

Expression Patterns of Glyma15g05863

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g05863 not represented in the dataset	Glyma15g05863 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g05863 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g053200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g05863

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g05863

Limit To All Plant Sequences

>Glyma15g05863.1   sequence type=CDS   gene model=Glyma15g05863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGATAGTTGAGTTAAAAGTGGAAATGGTTGGAATACACGAGAAAAGACTAAGGAAATGCCTCGCAAAATTGAAAGGTTGGTTTGGGATAGAGAAGGTGGAAGTGGATTGTAACAGCCAGAAGGTTGTAGTGACGGGATACGCACACAAGAACAAAATCCTAAAAGCATTGAGAAAAGCTGGTCTCAAGGCTCATTTCTGGTCTTCTAAAAATGACTTGCTTAATGCTTATCTCAGTGCTAGTTATGCCAACCTCAAATTTAACAACTTCAGCATCTTCTAG

Predicted protein sequences of Glyma15g05863

Limit To All Plant Sequences

>Glyma15g05863.1   sequence type=predicted peptide   gene model=Glyma15g05863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEIVELKVEMVGIHEKRLRKCLAKLKGWFGIEKVEVDCNSQKVVVTGYAHKNKILKALRKAGLKAHFWSSKNDLLNAYLSASYANLKFNNFSIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain