SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g05620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g05620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g05620

Feature Type:gene_model
Chromosome:Gm15
Start:3964609
stop:3967870
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15120AT Annotation by Michelle Graham. TAIR10: Ubiquinol-cytochrome C reductase hinge protein | chr1:5203091-5203897 FORWARD LENGTH=69 SoyBaseE_val: 3.00E-39ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006122GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, ubiquinol to cytochrome c SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005750GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III SoyBaseN/AISS
GO:0008121GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquinol-cytochrome-c reductase activity SoyBaseN/AISS
KOG4763 KOG Ubiquinol-cytochrome c reductase hinge protein JGI ISS
PTHR15336Panther UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 7.8 KDA PROTEIN JGI ISS
PF02320PFAM Ubiquinol-cytochrome C reductase hinge protein JGI ISS
UniRef100_C6T1W4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1W4_SOYBN SoyBaseE_val: 2.00E-43ISS
UniRef100_G7IL87UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b-c1 complex subunit n=1 Tax=Medicago truncatula RepID=G7IL87_MEDTR SoyBaseE_val: 7.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g05620 not represented in the dataset

Glyma15g05620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g19380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g050500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g05620.1   sequence type=CDS   gene model=Glyma15g05620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGACGAGGAACCTGTTGATCAGAAGAGATATCTTGAAGAGTCTTGCAAACCAAAATGTGTAAAACCATTACTGGAATACCAGGCGTGCATTAAAAGGATACATGGTGATGATTCTGGGCAGAAACACTGCACTGGACAATATTTTGATTATTGGTCTTGTATTGACAAATGTGTTGCACCGAAGCTATTCACCAAACTGAAGTAA

>Glyma15g05620.1   sequence type=predicted peptide   gene model=Glyma15g05620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADEEPVDQKRYLEESCKPKCVKPLLEYQACIKRIHGDDSGQKHCTGQYFDYWSCIDKCVAPKLFTKLK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo