SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g05560

Feature Type:gene_model
Chromosome:Gm15
Start:3940731
stop:3942961
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43670AT Annotation by Michelle Graham. TAIR10: Inositol monophosphatase family protein | chr1:16468184-16470347 FORWARD LENGTH=341 SoyBaseE_val: 3.00E-54ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005983GO-bp Annotation by Michelle Graham. GO Biological Process: starch catabolic process SoyBaseN/AISS
GO:0005986GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose biosynthetic process SoyBaseN/AISS
GO:0006000GO-bp Annotation by Michelle Graham. GO Biological Process: fructose metabolic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0030388GO-bp Annotation by Michelle Graham. GO Biological Process: fructose 1,6-bisphosphate metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0042132GO-mf Annotation by Michelle Graham. GO Molecular Function: fructose 1,6-bisphosphate 1-phosphatase activity SoyBaseN/AISS
GO:0042578GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoric ester hydrolase activity SoyBaseN/AISS
PTHR11556Panther FRUCTOSE-1,6-BISPHOSPHATASE-RELATED JGI ISS
PTHR11556:SF8Panther SUBFAMILY NOT NAMED JGI ISS
PF00316PFAM Fructose-1-6-bisphosphatase JGI ISS
UniRef100_G7IL84UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytosolic fructose-1 6-bisphosphatase n=1 Tax=Medicago truncatula RepID=G7IL84_MEDTR SoyBaseE_val: 2.00E-63ISS
UniRef100_I1MDT3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDT3_SOYBN SoyBaseE_val: 1.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g19430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g050100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g05560.1   sequence type=CDS   gene model=Glyma15g05560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCACCAAGCTGACACTAACAGAACTGATTTGATGACTATCACAGGCTTTGTAGGGAAAACAATGTTAATATGTTATGTTCTCATGCGGGATTGGCGAAACTCCTATGCTGGAGAGACCAATGCTAAAGGTGAGGAGCAAAAGAAATTGGATGTGCTTTCAAATGAATTATTTGTGAAAGCCTTAATCAGCAGTGGACGCAGATGCCTTCTTGTTTCTGAAGAGGTTGAAGAGGCTATATTTGTGCCATCATCACATCGTGGCAAATACATTGTTGTGTTTGATCCTTGGATGGATCCTCAAACATTGACTGCGGGGTTTCTATTGGAACTTCTTGAAGATGCATTGCAACCTGGGAACCAAATGTTAGCAGCTGGTTACTGCATGTATGGAAGCTCTTGCACGTTCGTGCTTAGCAAAGGAAATGGAGTGAAGTTCATATTGACTCACCCAAACATCAAGATACCAAGTAAAGGAAAGATTTATTCGGTGAATGAAGGAAATGTGTTCATTCTAACATTGATGAGTAATGCAGTATGGTTGCTGATATCCATCGAACTTTGCTTTATGGTGGCATCTTCATGTACCCTGCTGATTCTTTCCAATGTCATATTTGATGGAGCAAGCAGGAGGTCAGGCTTTCACAGGAAAAAATACATGAAGGATTACCAGTATTCCTTGGCAGCTACGATGACATGGAGCAAATGA

>Glyma15g05560.1   sequence type=predicted peptide   gene model=Glyma15g05560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHQADTNRTDLMTITGFVGKTMLICYVLMRDWRNSYAGETNAKGEEQKKLDVLSNELFVKALISSGRRCLLVSEEVEEAIFVPSSHRGKYIVVFDPWMDPQTLTAGFLLELLEDALQPGNQMLAAGYCMYGSSCTFVLSKGNGVKFILTHPNIKIPSKGKIYSVNEGNVFILTLMSNAVWLLISIELCFMVASSCTLLILSNVIFDGASRRSGFHRKKYMKDYQYSLAATMTWSK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo