SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g05510

Feature Type:gene_model
Chromosome:Gm15
Start:3894129
stop:3894831
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g05510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G25275AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr1:8860719-8861156 FORWARD LENGTH=85 SoyBaseE_val: 6.00E-15ISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B9DG55UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT1G25275 protein n=1 Tax=Arabidopsis thaliana RepID=B9DG55_ARATH SoyBaseE_val: 3.00E-12ISS
UniRef100_I1MDS8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDS8_SOYBN SoyBaseE_val: 6.00E-64ISS

Expression Patterns of Glyma15g05510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g05510
ParalogEvidenceComments
Glyma08g19510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g05510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g049600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g05510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g05510
>Glyma15g05510.1   sequence type=CDS   gene model=Glyma15g05510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAGATGGTGGTTGCAATGATGCTTATATTTCTTCTAATTTCTACGCAAATGGAGAGCGTTGAGCCCGATGCTGCAGATTGCTTGGATGGTTGCACTACTGCCTGTGTTCAAAGCGACTCGAGGCTTCAAGCACGGTGTGATCGCAAGTGCAGCATTAGATGCGGTCCAGGTAACCAACCTAATCCCAAATATTTCTTCTTCATACTTACAATGCTATATATCGATATTTCATGGATGGATAAAAAAAAAGAAAAAGACAAAATGATATTTTGTCTTTTGACCTAG
Predicted protein sequences of Glyma15g05510
>Glyma15g05510.1   sequence type=predicted peptide   gene model=Glyma15g05510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKMVVAMMLIFLLISTQMESVEPDAADCLDGCTTACVQSDSRLQARCDRKCSIRCGPGNQPNPKYFFFILTMLYIDISWMDKKKEKDKMIFCLLT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo