SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g05290

Feature Type:gene_model
Chromosome:Gm15
Start:3756410
stop:3759229
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g05290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26070AT Annotation by Michelle Graham. TAIR10: Plastid-lipid associated protein PAP / fibrillin family protein | chr3:9526904-9528199 FORWARD LENGTH=242 SoyBaseE_val: 1.00E-84ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
PF04755PFAM PAP fibrillin JGI ISS
UniRef100_A2Q498UniRef Annotation by Michelle Graham. Most informative UniRef hit: PAP fibrillin n=1 Tax=Medicago truncatula RepID=A2Q498_MEDTR SoyBaseE_val: 7.00E-135ISS
UniRef100_I1MDQ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDQ3_SOYBN SoyBaseE_val: 2.00E-179ISS

Expression Patterns of Glyma15g05290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g05290
ParalogEvidenceComments
Glyma08g19730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g05290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g047700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g05290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g05290
>Glyma15g05290.1   sequence type=CDS   gene model=Glyma15g05290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTTTGCGTTCCCACTGCCACTGCTACTCTGCCATTCAAATGTATAATTGATTCCCACTCTTCAAAGCCAACTTCTCTATTCTCATTCTCACCAAAAAAATTGAACACCACCCCCCACCTCAACCTCATATTACAAGTACAAGTAGCTGATTCTGGCAAGTGGAGGAACATGGTTTCATTTTTCCCAGGTTTTCTAACTAAAGGTAGCGATGTTCAGAAGCTCAAGGTGGAGCTCTATGAAGCAATTGCACCCCTTGACCGAGGTGCCGAGGCTACTCCTGAGGACCAACAACGTGTGGACCAGATTGCTCGTAAACTTGAGGCTGTGAATCCTGTTAAGGAGCCTCTCAAGTCTGGTTTGCTCAATGGGAAATGGGAGCTTTTCTATACAACATCTCAATCAATTCTGCAAACACAGAGACCGAAACTCTTGCGACCAAATGGAAAGATCTATCAGGCAATTAATGTGGATACCTTGAGAGCTCAAAATATAGAAACTTGGCCGTTCTACAACCAGGCCACTGCCAATTTAGTGCCTCTTAACTCAAAAAGGGTGGCTGTCAAGTTTGACTTCTTCAAGATTGCTAGTCTGATACCTATTAAATCACCTGGGAGTGGTCGTGGTCAATTGGAAATTACTTATTTGGATGAAGATCTACGAATATCAAGAGGAAATAGAGGTAATTTGTTCATCTTGAAAATGGTGGATCCATCCTATAGAGTCCCTCTTTGA
Predicted protein sequences of Glyma15g05290
>Glyma15g05290.1   sequence type=predicted peptide   gene model=Glyma15g05290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALCVPTATATLPFKCIIDSHSSKPTSLFSFSPKKLNTTPHLNLILQVQVADSGKWRNMVSFFPGFLTKGSDVQKLKVELYEAIAPLDRGAEATPEDQQRVDQIARKLEAVNPVKEPLKSGLLNGKWELFYTTSQSILQTQRPKLLRPNGKIYQAINVDTLRAQNIETWPFYNQATANLVPLNSKRVAVKFDFFKIASLIPIKSPGSGRGQLEITYLDEDLRISRGNRGNLFILKMVDPSYRVPL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo