SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g05030

Feature Type:gene_model
Chromosome:Gm15
Start:3602032
stop:3604256
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g05030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28500AT Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 11 | chr2:12186603-12188110 REVERSE LENGTH=232 SoyBaseE_val: 2.00E-73ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF03195PFAM Protein of unknown function DUF260 JGI ISS
UniRef100_G7IKN3UniRef Annotation by Michelle Graham. Most informative UniRef hit: LOB domain protein n=1 Tax=Medicago truncatula RepID=G7IKN3_MEDTR SoyBaseE_val: 2.00E-101ISS
UniRef100_I1MDM7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MDM7_SOYBN SoyBaseE_val: 8.00E-118ISS

Expression Patterns of Glyma15g05030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g05030
ParalogEvidenceComments
Glyma13g40370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g05030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g045200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g05030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g05030
>Glyma15g05030.1   sequence type=CDS   gene model=Glyma15g05030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCCCTTGTGCTGCTTGCAAGATTCTGAGGCGAAGATGTGCTGAGAAATGTGTCTTGGCACCTTATTTCCCTCTCACTGAACCTTCCAAGTTTACCACTGCACACCGAGTCTTCGGTGCCAGCAACATCATCAAGTTCTTGCAGGAACTTCCAGAGTCTCAAAGAGCTGATGCAGTGGCCAGCATGGTTTATGAGGCTGGTGCAAGAATAAGAGACCCAGTATATGGATGTGCAGGTGCAATTTGCCAGCTTCAAAAGCAAGTCAATGAACTTCAAGCACAGTTAGCAAAGGCACAAGCTGAGGTTGTAAACATGCAACTCCAACAAGCCAATCTGGTGGCTCTAATTTGCATGGAAATGGCACAAACACAAACTCCACAGGAATATTCACCACAACAATCTGTGGACAACTTCATTTCAAGCACTTCCCACAGCAGTGGCTATCAAAACAATCTCAATTTCTTTGAGGAGAACACCAATAACCTAAACTCTTTGTGGGAGCCTCTTTGGACATGA
Predicted protein sequences of Glyma15g05030
>Glyma15g05030.1   sequence type=predicted peptide   gene model=Glyma15g05030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPCAACKILRRRCAEKCVLAPYFPLTEPSKFTTAHRVFGASNIIKFLQELPESQRADAVASMVYEAGARIRDPVYGCAGAICQLQKQVNELQAQLAKAQAEVVNMQLQQANLVALICMEMAQTQTPQEYSPQQSVDNFISSTSHSSGYQNNLNFFEENTNNLNSLWEPLWT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo