SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g04530

Feature Type:gene_model
Chromosome:Gm15
Start:3168818
stop:3169846
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g04530
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02560AT Annotation by Michelle Graham. TAIR10: histone H2A 12 | chr5:575437-576456 FORWARD LENGTH=153 SoyBaseE_val: 5.00E-81ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG1756 KOG Histone 2A JGI ISS
PTHR23430Panther HISTONE H2A JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_I1MDH5UniRef Annotation by Michelle Graham. Best UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=I1MDH5_SOYBN SoyBaseE_val: 7.00E-98ISS
UniRef100_I1MDH5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=I1MDH5_SOYBN SoyBaseE_val: 7.00E-98ISS

Expression Patterns of Glyma15g04530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g04530 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g040300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g04530
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g04530
>Glyma15g04530.1   sequence type=CDS   gene model=Glyma15g04530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGCTGACGGAAAGATCAAGAAGGGCGCCGGCGGAAGAAAGGGCGGCGGCCCAAAGAAGAAGCCGGTTTCAAGGTCCGTCAAAGCCGGTCTCCAATTCCCCGTCGGAAGAATTGGCCGTTATTTGAAGAAAGGAAGGTACGCTCAGCGTGTCGGTACCGGTGCTCCCGTATACTTGGCTGCAGTTCTCGAATACCTAGCTGCCGAGGTGCTTGAGTTGGCTGGGAATGCAGCACGTGACAACAAGAAGAACAGGATTATTCCAAGACACGTGCTTTTGGCAGTGAGGAACGATGAGGAGTTGGGGAAATTGCTTGCTGGAGTGACAATTGCACATGGTGGCGTGCTTCCAAACATTAACCCTGTTTTGTTGCCTAAGAAGTCTGAGAGGGCTTCCAAGGAACCTAAATCTCCATCCAAGGCTACTAAATCTCCTAAGAAGGCTTAA
Predicted protein sequences of Glyma15g04530
>Glyma15g04530.1   sequence type=predicted peptide   gene model=Glyma15g04530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDADGKIKKGAGGRKGGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLPKKSERASKEPKSPSKATKSPKKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo