SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g04300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g04300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g04300

Feature Type:gene_model
Chromosome:Gm15
Start:3017137
stop:3019754
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28900AT Annotation by Michelle Graham. TAIR10: outer plastid envelope protein 16-1 | chr2:12414423-12415459 REVERSE LENGTH=148 SoyBaseE_val: 3.00E-61ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0045037GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009527GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid outer membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009707GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast outer membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
PTHR15371Panther TIM23 JGI ISS
PF02466PFAM Tim17/Tim22/Tim23 family JGI ISS
UniRef100_C6SW13UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SW13_SOYBN SoyBaseE_val: 3.00E-99ISS
UniRef100_Q41050UniRef Annotation by Michelle Graham. Most informative UniRef hit: Outer envelope pore protein 16, chloroplastic n=1 Tax=Pisum sativum RepID=OEP16_PEA SoyBaseE_val: 3.00E-75ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g04300 not represented in the dataset

Glyma15g04300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g41110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g038200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g04300.1   sequence type=CDS   gene model=Glyma15g04300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTGGGTGAGGCTTTCAGAGTCTCCAAGGCTCGACGTTGCTATTGACATGGGTAATCCATTTCTCAATCTCACTGTTGATGGTTTCCTTAAGATCGGAGCTGTCGCAGCCACGCGATCAGCTGCTGAAGATACTTATCATATTATCCAAAAGGGGAATATCTCAAGTCGTGATTTCGAGAAAACTTTGAAGAAGATGTGTAAAGAAGGTGTATATTGGGGAACTATAGCTGGCGTTTATGTTGGAATGGAATATGGGGTAGAGAGGATCCGTGGCACCAGAGACTGGAAGAATGCCATGATTGGGGGTGCAGTAACTGGGGCCCTGGTATCTGCAGCCAGCAACAACAAGAAAGACAAGATTGCGATAGATGCCATTACTGGGGCAGCAATTGCTACTGCTGCAGAGTTTATAAATTACCTTACCTGA

>Glyma15g04300.1   sequence type=predicted peptide   gene model=Glyma15g04300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPWVRLSESPRLDVAIDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHIIQKGNISSRDFEKTLKKMCKEGVYWGTIAGVYVGMEYGVERIRGTRDWKNAMIGGAVTGALVSAASNNKKDKIAIDAITGAAIATAAEFINYLT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo