SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g04290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g04290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g04290

Feature Type:gene_model
Chromosome:Gm15
Start:3009285
stop:3012671
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g04290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55440AT Annotation by Michelle Graham. TAIR10: triosephosphate isomerase | chr3:20553794-20556078 FORWARD LENGTH=254 SoyBaseE_val: 3.00E-152ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0044262GO-bp Annotation by Michelle Graham. GO Biological Process: cellular carbohydrate metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004807GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolysis SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
KOG1643 KOG Triosephosphate isomerase JGI ISS
PTHR21139Panther TRIOSEPHOSPHATE ISOMERASE JGI ISS
PF00121PFAM Triosephosphate isomerase JGI ISS
UniRef100_Q38IW8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Triosephosphate isomerase n=1 Tax=Glycine max RepID=Q38IW8_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI0001B8376BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B8376B related cluster n=1 Tax=unknown RepID=UPI0001B8376B SoyBaseE_val: 0ISS

Expression Patterns of Glyma15g04290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g04290 not represented in the dataset
Glyma15g04290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g04290
ParalogEvidenceComments
Glyma13g41120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g04290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g038100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g04290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma15g04290
>Glyma15g04290.2   sequence type=transcript   gene model=Glyma15g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAAGGCAAAGGAAACGCCCTAAAGCATATTCGGTTTATGCGCATTATTATAAAGAGTGATAAGGTTGTTTGGACGGTCACTCGCAGTTGTATTGTTGAACAAGGGTTTCTCTGTCTGCTTCTTCACTTTCTCTCGTTTCAATCGAAACCAAAACAAAATCATGGGCAGAAAATTCTTCGTTGGTGGCAACTGGAAATGCAATGGGACCACTGAGGAGGTAAAGAAGATTGTTACTACTTTGAATGAGGCTAAAGTCCCTGGAGAAGATGTCGTAGAAGTTGTTGTGAGCCCTCCTTTTGTGTTCCTTCCTGTTGTAAAAAGTTTGCTGCGCCCTGATTTCCATGTTTCGGCACAAAACTGTTGGGTTCGCAAAGGTGGTGCTTATACCGGTGAGGTTAGTGCTGAAATGCTTGTTAATTTGGGAATTCCTTGGGTTATTATTGGTCACTCTGAACGGAGGCAGCTTTTAAATGAATCAAATGAGTTTGTGGGAGATAAAGTTGCCTATGCACTTCAACAAGGTCTAAAAGTTATTGCATGCATTGGGGAGACTCTCGAACAGCGTGAAGCTGGTACAACAACGGCTGTTGTTTCTGAGCAAACAAAAGCAATTGCAGCTAAAATATCAAATTGGGACAATGTCGTTTTGGCCTACGAGCCAGTTTGGGCCATTGGAACAGGAAAGGTTGCTACTCCTGCTCAGGCTCAAGAGGTATGCTTGCCTATATTTTGTTAACAGTACAATTGTTTTGGTGAAAACTTGCTTGCCACTATGCTGTTTTTTTTTTGTGTGTGAATTTTATTGTTCTCACATATTCTAGATTGTGTAACTTTATCTGATATCTTTTTGTTCTTTGCTCTTTTGCCCATTTAGACATTTGATACCTCTCATAATAGTGACTTGTAGATTATGTTCTATTGACAATGTTTGTGGGGTGTTTGGCCTAGGTCCATGCTGATTTGAGGAAATGGGTTCATGACAATGTGAGTGCTGAAGTTGCTGCATCTGTAAGAATTATCTATGGAGGTTCTGTAAATGGAGGAAACTGCAAAGAATTGGCCGCACAGCCCGATGTTGATGGATTTTTGGTTGGTGGTGCCTCCCTGAAGCCGGAGTTCGTGGACATCATAAATGCTGCCACTGTGAAGAAGAATTGAAATTCGTAGTTAGGAACTGATATAATGCTGCCTTTCAAGCTGCTTCGGAAATTGCTGTTTTTGAGTTTTGGATCTGTGCTTTGTGGCCAATGTTTTGAACTCTGTTTAGTACTGAATAAACACGCTTTCCTTTGAGATCTCATCCATAGGCGATCAATTGGATTTTGATTAAATTTCTGAATGCAAAAATAGTGTAACTACCATAACATTTGGTGGGTAAATAATGTTGAACGCCTAGTTGACTGTACTTAATCGTCACGTTCTTTACTACTGTTTATGCACGTATCACTTAGATCATGTTTAATTTTTGTTGGGATGCATTTTGTACAGTAAAGGTAAAGGATCTAACCCTAGATAGAGATGTGCCAATCACGAGAACTTCAACTTTTGTATCTACAAGCAGTTAAGTTAAATAAATA
Coding sequences of Glyma15g04290
>Glyma15g04290.1   sequence type=CDS   gene model=Glyma15g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGAAAATTCTTCGTTGGTGGCAACTGGAAATGCAATGGGACCACTGAGGAGGTAAAGAAGATTGTTACTACTTTGAATGAGGCTAAAGTCCCTGGAGAAGATGTCGTAGAAGTTGTTGTGAGCCCTCCTTTTGTGTTCCTTCCTGTTGTAAAAAGTTTGCTGCGCCCTGATTTCCATGTTTCGGCACAAAACTGTTGGGTTCGCAAAGGTGGTGCTTATACCGGTGAGGTTAGTGCTGAAATGCTTGTTAATTTGGGAATTCCTTGGGTTATTATTGGTCACTCTGAACGGAGGCAGCTTTTAAATGAATCAAATGAGTTTGTGGGAGATAAAGTTGCCTATGCACTTCAACAAGGTCTAAAAGTTATTGCATGCATTGGGGAGACTCTCGAACAGCGTGAAGCTGGTACAACAACGGCTGTTGTTTCTGAGCAAACAAAAGCAATTGCAGCTAAAATATCAAATTGGGACAATGTCGTTTTGGCCTACGAGCCAGTTTGGGCCATTGGAACAGGAAAGGTTGCTACTCCTGCTCAGGCTCAAGAGGTCCATGCTGATTTGAGGAAATGGGTTCATGACAATGTGAGTGCTGAAGTTGCTGCATCTGTAAGAATTATCTATGGAGGTTCTGTAAATGGAGGAAACTGCAAAGAATTGGCCGCACAGCCCGATGTTGATGGATTTTTGGTTGGTGGTGCCTCCCTGAAGCCGGAGTTCGTGGACATCATAAATGCTGCCACTGTGAAGAAGAATTGA

>Glyma15g04290.2   sequence type=CDS   gene model=Glyma15g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGAAAATTCTTCGTTGGTGGCAACTGGAAATGCAATGGGACCACTGAGGAGGTAAAGAAGATTGTTACTACTTTGAATGAGGCTAAAGTCCCTGGAGAAGATGTCGTAGAAGTTGTTGTGAGCCCTCCTTTTGTGTTCCTTCCTGTTGTAAAAAGTTTGCTGCGCCCTGATTTCCATGTTTCGGCACAAAACTGTTGGGTTCGCAAAGGTGGTGCTTATACCGGTGAGGTTAGTGCTGAAATGCTTGTTAATTTGGGAATTCCTTGGGTTATTATTGGTCACTCTGAACGGAGGCAGCTTTTAAATGAATCAAATGAGTTTGTGGGAGATAAAGTTGCCTATGCACTTCAACAAGGTCTAAAAGTTATTGCATGCATTGGGGAGACTCTCGAACAGCGTGAAGCTGGTACAACAACGGCTGTTGTTTCTGAGCAAACAAAAGCAATTGCAGCTAAAATATCAAATTGGGACAATGTCGTTTTGGCCTACGAGCCAGTTTGGGCCATTGGAACAGGAAAGGTTGCTACTCCTGCTCAGGCTCAAGAGGTATGCTTGCCTATATTTTGTTAA
Predicted protein sequences of Glyma15g04290
>Glyma15g04290.1   sequence type=predicted peptide   gene model=Glyma15g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDFHVSAQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNEFVGDKVAYALQQGLKVIACIGETLEQREAGTTTAVVSEQTKAIAAKISNWDNVVLAYEPVWAIGTGKVATPAQAQEVHADLRKWVHDNVSAEVAASVRIIYGGSVNGGNCKELAAQPDVDGFLVGGASLKPEFVDIINAATVKKN*

>Glyma15g04290.2   sequence type=predicted peptide   gene model=Glyma15g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDFHVSAQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNEFVGDKVAYALQQGLKVIACIGETLEQREAGTTTAVVSEQTKAIAAKISNWDNVVLAYEPVWAIGTGKVATPAQAQEVCLPIFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo