Report for Sequence Feature Glyma15g04220
Feature Type: gene_model
Chromosome: Gm15
Start: 2959226
stop: 2961511
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g04220
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G59400 AT
Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: PGR5-like B (TAIR:AT4G11960.1); Has 97 Blast hits to 97 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 97; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:23957756-23959518 FORWARD LENGTH=299
SoyBase E_val: 2.00E-111 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_G7IHP7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: PGR5-like protein n=1 Tax=Medicago truncatula RepID=G7IHP7_MEDTR
SoyBase E_val: 4.00E-142 ISS
UniRef100_I1MDE6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MDE6_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma15g04220
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma15g04220
Paralog Evidence Comments
Glyma13g41180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g04220 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g037500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g04220
Coding sequences of Glyma15g04220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g04220.1 sequence type=CDS gene model=Glyma15g04220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAAGTGAAGGTGATGGGGTTCAGCGTGATACCCAAAATCAGAAGCAGCAGCGTTTGCCTGTTCTCCGTTCGAGCCTGCCACGAACTCCCTCATGGACCTTCCTGCATCTACGTTGGCCCCCTCCACACCGCAACCCAAGAGACCCTCGAAGCTCTTTACTCTCAGGCTCGTGATGCTTATTACAGTGGAGACCCTTTGATACTTGATGACATGTTTGATAGAGTAGAGTTGAAGCTTAAGTGGTATGGTTCTAAGTCTGTTGTCAAGTATCCTCGATGCAGTATCAGGAGGCATTCTACCTATGCTGATGCTGACGAAGATCTGTCTATGGCTATTGCATTAGCAGGCTTATGGTCCCTATTTCTTGCTCTTGGCTGTTCTGCGTGTGTTTGGCCCATATATTACACTGTTAGCACTGCTTATCAGAAAGCATTCGACTCAGGATTATCATACGATAGCCCAGCATCAGTTCTAGGGCTTCTTTTCGTGGTGAATAGCATTATCTTCATGACACTGGGTTTGGCCATTGGCTACCCAGTTGCTTCAGCTTCAGTTAAGGTGCTTCAAGGTCTGTGGAGGAATGATTTAGCAGCACTAAAGGGTTCTTGTCCAAATTGTGGAGAAGAGGTATTTGCATTTGTGAGAACGGACAAGGCTAACAACTCTTCCCACAGAGCAGATTGTCATGTGTGTGAATGCTTATTGGAATTTCGCACCAAAGTTGAGCAATCGGCTTTAAGATTAGGGAGACAATGGGTTTATGGGCGTATTTACCTTGTTCGCAGATCCAGACGCCAAGGAGACCCGTAA
Predicted protein sequences of Glyma15g04220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g04220.1 sequence type=predicted peptide gene model=Glyma15g04220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKVKVMGFSVIPKIRSSSVCLFSVRACHELPHGPSCIYVGPLHTATQETLEALYSQARDAYYSGDPLILDDMFDRVELKLKWYGSKSVVKYPRCSIRRHSTYADADEDLSMAIALAGLWSLFLALGCSACVWPIYYTVSTAYQKAFDSGLSYDSPASVLGLLFVVNSIIFMTLGLAIGYPVASASVKVLQGLWRNDLAALKGSCPNCGEEVFAFVRTDKANNSSHRADCHVCECLLEFRTKVEQSALRLGRQWVYGRIYLVRRSRRQGDP*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
