SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g03761

Feature Type:gene_model
Chromosome:Gm15
Start:2635283
stop:2636602
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g03761
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20820AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein | chr3:7280930-7282027 FORWARD LENGTH=365 SoyBaseE_val: 1.00E-60ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF701Panther JGI ISS
UniRef100_C6ZS03UniRef Annotation by Michelle Graham. Best UniRef hit: Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZS03_SOYBN SoyBaseE_val: 1.00E-79ISS
UniRef100_C6ZS03UniRef Annotation by Michelle Graham. Most informative UniRef hit: Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZS03_SOYBN SoyBaseE_val: 1.00E-79ISS

Expression Patterns of Glyma15g03761
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g03761 not represented in the dataset
Glyma15g03761 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g03761
ParalogEvidenceComments
Glyma13g41650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g03761 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g03761
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g03761
>Glyma15g03761.1   sequence type=CDS   gene model=Glyma15g03761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGTGTTAGGTCTATAACGGTGGTGGTAGTAGTGTTATTTATTATGGCCCTGAGCTCCGGCGTGAAGTCGTGTCCGCCTTCGGACAGGACGGCGCTCCACGAGCCCTATCTCGGAATCTTCAACTCCTGGACCGGCGCCGACTGCTGCCATAAGTGGTACGGCGTGAGCTGCGACCAGGAGACCCGCCGCGTCGCCGACATCAACCTCCGCGGCGAGTCGGAGGAGCCGATCTTCGAGCGCGCCCACCGCACCGGCTACATGACCGGCTACATCTCGCCGGCGATCTGCAAGCTGGCGCGTCTCTCCAGCATCACAATCGCCGACTGGAGGGGAATATCCGGCGAGATCCCGCGCTGCATCACAACCCTCCCCTTCCTCCGCATCAAACAAAGGCATGATCACGTCGTTCTTTTCTTCGTTTTAATTGCAATCATTTCCTCGCATCAAACAATCGTTTTAATTGCAATCATTTCAAGTGCAGGGCGTCTCAAAGTTCTTTTATTAATGTTAATCTTATATTCTCAGTCTAGTGTGTGA
Predicted protein sequences of Glyma15g03761
>Glyma15g03761.1   sequence type=predicted peptide   gene model=Glyma15g03761   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGVRSITVVVVVLFIMALSSGVKSCPPSDRTALHEPYLGIFNSWTGADCCHKWYGVSCDQETRRVADINLRGESEEPIFERAHRTGYMTGYISPAICKLARLSSITIADWRGISGEIPRCITTLPFLRIKQRHDHVVLFFVLIAIISSHQTIVLIAIISSAGRLKVLLLMLILYSQSSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo