SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g03541

Feature Type:gene_model
Chromosome:Gm15
Start:2458257
stop:2460678
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g03541
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G05900AT Annotation by Michelle Graham. TAIR10: endonuclease III 2 | chr1:1786896-1789037 FORWARD LENGTH=314 SoyBaseE_val: 3.00E-63ISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006284GO-bp Annotation by Michelle Graham. GO Biological Process: base-excision repair SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0042644GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast nucleoid SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004519GO-mf Annotation by Michelle Graham. GO Molecular Function: endonuclease activity SoyBaseN/AISS
GO:0019104GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA N-glycosylase activity SoyBaseN/AISS
GO:0051539GO-mf Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding SoyBaseN/AISS
PTHR10359Panther A/G-SPECIFIC ADENINE GLYCOSYLASE/ENDONUCLEASE III JGI ISS
PTHR10359:SF16Panther ENDONUCLEASE III JGI ISS
PF00633PFAM Helix-hairpin-helix motif JGI ISS
PF00730PFAM HhH-GPD superfamily base excision DNA repair protein JGI ISS
UniRef100_G7IHS6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Endonuclease III-like protein n=1 Tax=Medicago truncatula RepID=G7IHS6_MEDTR SoyBaseE_val: 5.00E-77ISS
UniRef100_UPI000233AF41UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AF41 related cluster n=1 Tax=unknown RepID=UPI000233AF41 SoyBaseE_val: 1.00E-94ISS

Expression Patterns of Glyma15g03541
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g03541 not represented in the dataset
Glyma15g03541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g03541
ParalogEvidenceComments
Glyma13g41881 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g03541 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g03541
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g03541
>Glyma15g03541.1   sequence type=CDS   gene model=Glyma15g03541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGTGGTTTCTTTGGGGCGAATCCATGTGTGTGCCAAAACAAGAACATGCTTTTCCTCAAAATTCCATCTCCTTAAACTTCATACTTTCACTCCTGCTTCTGCTTCAGTGTCCCAACTTGGAGTCTCTGAGAGTGACAAGAAAACCAAAAAAAGCTCGCAACTTCAACACGTGCCGGAAACGGAATTTGAAGACCATAAAGAGATCCTAGGATTTGCACATACAGGACCAAATGAATCGGCTCAAAGTTGTAGTGAGGCCCCTGCACATTGGGAAATGGTTCTTCAAGGAATTCGCCAAATGAGGAGTTCTGCAGATGAACACCAACCGGTTGCACGTGAGAAAGCCGCTGATACTGTACCTTCTAAGGAAAGAAGATTTGTTGTCCTGGCATCTTCCCTTTTATCAAGCCAAACTAAGGAAAAGGTTACTCGTGGAGCAACTCAAAGTCTTCGTGAAAATGGTCTGCTTAGCGCTGATGCAATGAACAAAGCTGATGAAGAAACCATCAAAAAGTTGATTTACCCTGTTGGATTTTATACGAGAAAAGTCAGTAACTTGAAGAAAATTGCCAATATTTGTCTCATGAAATATGATGGAGACATTCCTAGCTCAATTGAGGAACTACTCTTGCTGCCAGGAGTTGGTCCTAAGATTGCTCATTTGGTGCTTATGATTGTTGGATGGAACAATGTCCAAGGGATATGTGTAGATACTCAT
Predicted protein sequences of Glyma15g03541
>Glyma15g03541.1   sequence type=predicted peptide   gene model=Glyma15g03541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVVSLGRIHVCAKTRTCFSSKFHLLKLHTFTPASASVSQLGVSESDKKTKKSSQLQHVPETEFEDHKEILGFAHTGPNESAQSCSEAPAHWEMVLQGIRQMRSSADEHQPVAREKAADTVPSKERRFVVLASSLLSSQTKEKVTRGATQSLRENGLLSADAMNKADEETIKKLIYPVGFYTRKVSNLKKIANICLMKYDGDIPSSIEELLLLPGVGPKIAHLVLMIVGWNNVQGICVDTH






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo