Glyma15g03091 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g03091): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g03091): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g03091

Feature Type:	gene_model
Chromosome:	Gm15
Start:	2156451
stop:	2157062
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g03091

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28950	AT	Annotation by Michelle Graham. TAIR10: expansin A6 \| chr2:12431840-12433482 REVERSE LENGTH=257	SoyBase	E_val: 2.00E-56	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0006949	GO-bp	Annotation by Michelle Graham. GO Biological Process: syncytium formation	SoyBase	N/A	ISS
GO:0007020	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule nucleation	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009828	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening	SoyBase	N/A	ISS
GO:0009831	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification involved in multidimensional cell growth	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
PF01357	PFAM	Pollen allergen	JGI		ISS
PF03330	PFAM	Rare lipoprotein A (RlpA)-like double-psi beta-barrel	JGI		ISS
UniRef100_G9FTF8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expansin A5 n=1 Tax=Glycine max RepID=G9FTF8_SOYBN	SoyBase	E_val: 2.00E-57	ISS
UniRef100_UPI000233AEC0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AEC0 related cluster n=1 Tax=unknown RepID=UPI000233AEC0	SoyBase	E_val: 1.00E-67	ISS

Expression Patterns of Glyma15g03091

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g03091 not represented in the dataset	Glyma15g03091 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g03091 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g026700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g03091

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g03091

Limit To All Plant Sequences

>Glyma15g03091.1   sequence type=CDS   gene model=Glyma15g03091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGCAAACGACAAGCAGTGGTGTGGTGTCACTCCGGCAAGCCTTCCATCTTCATCACCGCCAACAACTTCGGTCCCCCTAACTACGCTCTTCCAAACGACAATGGCGGCTGGTGCAACCCTCCTCGCCCTCACTTCGACCTCGCCATGCCCATGTTCCTTAAAATCGCCGAATACCGCGCCGGCATCGTACCTGTCGGCTTCCGCGGGGTGACATGTAGGAAGCATGGTGGGATCAGGTTCACAATAAACGGTTTCCGTTACTTTAACCTGGTTTTGATCAGCAACGTAGCGGGTGCAGGGGATATCGTGCACGCTTCAGAGTGA

Predicted protein sequences of Glyma15g03091

Limit To All Plant Sequences

>Glyma15g03091.1   sequence type=predicted peptide   gene model=Glyma15g03091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKRQAVVWCHSGKPSIFITANNFGPPNYALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVGFRGVTCRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHASE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain