SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g03070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g03070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g03070

Feature Type:gene_model
Chromosome:Gm15
Start:2152769
stop:2155011
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72750AT Annotation by Michelle Graham. TAIR10: translocase inner membrane subunit 23-2 | chr1:27383577-27384143 FORWARD LENGTH=188 SoyBaseE_val: 5.00E-78ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005744GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG3324 KOG Mitochondrial import inner membrane translocase, subunit TIM23 JGI ISS
PTHR15371Panther TIM23 JGI ISS
PF02466PFAM Tim17/Tim22/Tim23 family JGI ISS
UniRef100_G7IS28UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translocase of inner mitochondrial membrane TIM23 n=1 Tax=Medicago truncatula RepID=G7IS28_MEDTR SoyBaseE_val: 9.00E-89ISS
UniRef100_I1MD23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MD23_SOYBN SoyBaseE_val: 4.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g03070 not represented in the dataset

Glyma15g03070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g42300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g026600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g03070.1   sequence type=CDS   gene model=Glyma15g03070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTACCAGACACCCGATCAAGATTCAAGCTCCGATCCGAAGACCCCAACTCGCCTCTACAACCCATACAAGGACCTCGAAGTCCCCATTCGCAACCTCTACCAGCTCCCAACCACTCCCGAGTACCTATTCGTTGAGGAGGCCCGCCGCAAGCGCCGATCCTGGGGCGAGAACCTCACCTTCTACACCGGCTGCGGCTACCTTGCCGGCGCTGTCGGGGGCGCCGCCTCTGGTCTCATCGACGGTGTTAAATCCTTCGAGTCCGGCGACACCGCCAAGCTCCGAGTCAACCGCGTCCTCAACTCCTCCGGCCACGCCGGCCGCGCCTGGGGCAACCGCCTCGGCGTCATCGGCCTCCTCTACGCCGGCATCGAGAGCGGGATCGTGGCGGCGAGGGACACCGACGACGTCTGGAACAGCGTCGCGGCCGGACTCGGCACTGGCGCGCTGTATCGCGCCGCGAGAGGGGTGCGTTCGGCGGCGGTGGCGGGAGCCGTCGGCGGCGTCGTGGTTGGAGTCGCTGTCACGGCGAAGCAGGCTTTGAAACGCTACGTGCCTATATGA

>Glyma15g03070.1   sequence type=predicted peptide   gene model=Glyma15g03070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAYQTPDQDSSSDPKTPTRLYNPYKDLEVPIRNLYQLPTTPEYLFVEEARRKRRSWGENLTFYTGCGYLAGAVGGAASGLIDGVKSFESGDTAKLRVNRVLNSSGHAGRAWGNRLGVIGLLYAGIESGIVAARDTDDVWNSVAAGLGTGALYRAARGVRSAAVAGAVGGVVVGVAVTAKQALKRYVPI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo