SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g02730

Feature Type:gene_model
Chromosome:Gm15
Start:1880809
stop:1881447
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09270AT Annotation by Michelle Graham. TAIR10: importin alpha isoform 4 | chr1:2995162-2997833 FORWARD LENGTH=456 SoyBaseE_val: 5.00E-24ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0030581GO-bp Annotation by Michelle Graham. GO Biological Process: symbiont intracellular protein transport in host SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0080034GO-bp Annotation by Michelle Graham. GO Biological Process: host response to induction by symbiont of tumor, nodule or growth in host SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PTHR23316Panther IMPORTIN ALPHA-RELATED JGI ISS
PF00514PFAM Armadillo/beta-catenin-like repeat JGI ISS
UniRef100_I1NJ48UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NJ48_SOYBN SoyBaseE_val: 5.00E-26ISS
UniRef100_Q71VM4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Importin subunit alpha-1a n=2 Tax=Oryza sativa Japonica Group RepID=IMA1A_ORYSJ SoyBaseE_val: 2.00E-25ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g02730.1   sequence type=CDS   gene model=Glyma15g02730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCAAACGATGAAGAAGTATTGACTGATGCATGCTGGGCACTGTCATATCTTTCTGATGGCACAAATGATAAAATTCAAGCTGTAATTGAAGCTGGTGTTTGTCCCCGACTTGTTGAGCTGCTGCTGCACCCATTCCCTTCAGTGCTAATTCCTATGCATCAAGAAGGAAGCTTGTTGGACCATATCAAACGTCACAAC

>Glyma15g02730.1   sequence type=predicted peptide   gene model=Glyma15g02730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPFPSVLIPMHQEGSLLDHIKRHN







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo