Glyma15g02670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g02670

Feature Type:	gene_model
Chromosome:	Gm15
Start:	1815718
stop:	1818177
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g02670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G17710	AT	Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate phosphatase-related protein \| chr1:6090763-6091975 REVERSE LENGTH=279	SoyBase	E_val: 8.00E-107	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016791	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatase activity	SoyBase	N/A	ISS
GO:0052731	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphocholine phosphatase activity	SoyBase	N/A	ISS
GO:0052732	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoethanolamine phosphatase activity	SoyBase	N/A	ISS
KOG3120	KOG	Predicted haloacid dehalogenase-like hydrolase	JGI		ISS
PTHR20889	Panther	PHOSPHATASE, ORPHAN 1, 2	JGI		ISS
PF06888	PFAM	Putative Phosphatase	JGI		ISS
UniRef100_E5D6S8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acid phosphatase n=1 Tax=Phaseolus vulgaris RepID=E5D6S8_PHAVU	SoyBase	E_val: 2.00E-144	ISS
UniRef100_UPI000233B5DF	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B5DF related cluster n=1 Tax=unknown RepID=UPI000233B5DF	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g02670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g02670

Paralog	Evidence	Comments
Glyma13g42770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g02670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g023100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g02670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g02670

Limit To All Plant Sequences

>Glyma15g02670.2   sequence type=CDS   gene model=Glyma15g02670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGGAACGTTGTGGTTTTTGACTTCGACTCGACAATCATCGAGTGTGACAGTGATAATTGGGTTCTTGATGAGTTTGGTTTAACTGAAAAGTTCTATCAGCTTCTTCCTAACATGCCTTGGAACCCTCTGATGGATAAGATGATGAATGAACTTCATTCACAAGGAAAAACCATTGAAGACATTGTACAAGTTCTGAACAGGACTCCAATGCATCCCAGCATTGTCCCAGCCATTAAGGCATCATATTCCCTTGGGTGTGAGCTGAAGATTGTGAGCGACGCAAATATATTTTTCATTGAAACAATTTTGAAGCATCATGGGGTGTGGAATTGTTTCTCGGAGGTTATTGCAAACCCCAGTTATGTTAATGAAGAAGGGAGACTCCGAATTTCCCCCTACCATGATTTTCTAAAATGTTCTCATGGATGCAAAAATCCCTGCCCACCAAACATCTGCAAGGGAATGATCATAGAAAGGATCCAAAATTCGGTTGATGCTGCAGGAAAGAAATTCATCTATCTTGGAGATGGAAGTGTAGACTTTTGCCCTAGTTTGAAGCTCAAAGATAGGGATTATCTGATGCCAAGAAAGAATTTTCCATTGTGTGATTTAGTATCTGAAAACTCTAATCTCATAAAGGCAGAGGTACATGCTTGGAGAGATGGGGAAGAACTTTATGATGTTCTGCTCCATTTTATTAACAAAGCTATTGGTGAAGGAAACGGCAGTATTAGTAGTTCTACTCCAATAATATCCGTTGATTGCAAGTTGGAGTTCAATTGA

Predicted protein sequences of Glyma15g02670

Limit To All Plant Sequences

>Glyma15g02670.2   sequence type=predicted peptide   gene model=Glyma15g02670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGNVVVFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPNMPWNPLMDKMMNELHSQGKTIEDIVQVLNRTPMHPSIVPAIKASYSLGCELKIVSDANIFFIETILKHHGVWNCFSEVIANPSYVNEEGRLRISPYHDFLKCSHGCKNPCPPNICKGMIIERIQNSVDAAGKKFIYLGDGSVDFCPSLKLKDRDYLMPRKNFPLCDLVSENSNLIKAEVHAWRDGEELYDVLLHFINKAIGEGNGSISSSTPIISVDCKLEFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain