SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g02620

Feature Type:gene_model
Chromosome:Gm15
Start:1777967
stop:1779680
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g02620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51700AT Annotation by Michelle Graham. TAIR10: DOF zinc finger protein 1 | chr1:19174266-19174850 FORWARD LENGTH=194 SoyBaseE_val: 2.00E-43ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF02701PFAM Dof domain, zinc finger JGI ISS
UniRef100_G8A2U0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dof zinc finger protein n=1 Tax=Medicago truncatula RepID=G8A2U0_MEDTR SoyBaseE_val: 4.00E-73ISS
UniRef100_I1MCX8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCX8_SOYBN SoyBaseE_val: 2.00E-137ISS

Expression Patterns of Glyma15g02620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g02620
ParalogEvidenceComments
Glyma13g42820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g02620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g022800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g02620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g02620
>Glyma15g02620.1   sequence type=CDS   gene model=Glyma15g02620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGATCCAACGTTGTTCCAACCCATGAAACCCCACTTTCCGGAACAGGAGCAGCTTAAATGCCCGCGCTGTGACTCCACCAACACCAAGTTCTGCTACTACAACAACTACAACCTCTCGCAGCCACGCCATTTTTGCAAGAACTGCAGAAGGTATTGGACCAAAGGTGGTGCCTTGAGAAACATCCCTGTTGGTGGTGGAAGCAGAAAGAACACAAAGCGATCATCTTCATCCAACAACAACACCAAACGCGCTTCCCCATCACCCCCAGTTTCCTCTGCACCCGCTCCAGAACCCGACCCTACCCGGATTGGCCCCACCCCGGTTGTTGGTGGCGGGAGTTTCAGTTCCCTTTTGGCATCAAGTGGCCATTTGGGCCTGGGGAACCTCTTGGAGGGTCTGAATTCAAGTGGGTCTAATCTGAAAACTGTGCAAATGGAAGAGTTTGGGGAGAATGTTAGTTCGGGTCCGGTTGCGGATCCGGATTCGGGTCGGAATCCCGGGTTGGAGATGCAAAGCAATGGGAACGCAGAGAATTTTCTGAGTTTGCAAAATGGTGATTCAAGCTGTTGGAATGACATATGTCGTACTATTATGGAGGATCACAAACCAGAAGGCCACTGCTATAGGATCATTAGGTAA
Predicted protein sequences of Glyma15g02620
>Glyma15g02620.1   sequence type=predicted peptide   gene model=Glyma15g02620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQDPTLFQPMKPHFPEQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKNTKRSSSSNNNTKRASPSPPVSSAPAPEPDPTRIGPTPVVGGGSFSSLLASSGHLGLGNLLEGLNSSGSNLKTVQMEEFGENVSSGPVADPDSGRNPGLEMQSNGNAENFLSLQNGDSSCWNDICRTIMEDHKPEGHCYRIIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo