Glyma15g01911 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g01911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g01911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g01911

Feature Type:	gene_model
Chromosome:	Gm15
Start:	1261221
stop:	1263140
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g01911

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G69830	AT	Annotation by Michelle Graham. TAIR10: alpha-amylase-like 3 \| chr1:26288518-26293003 REVERSE LENGTH=887	SoyBase	E_val: 2.00E-19	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0005982	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch metabolic process	SoyBase	N/A	ISS
GO:0005983	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch catabolic process	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004556	GO-mf	Annotation by Michelle Graham. GO Molecular Function: alpha-amylase activity	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
GO:0043169	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation binding	SoyBase	N/A	ISS
UniRef100_I1KXQ4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXQ4_SOYBN	SoyBase	E_val: 1.00E-17	ISS
UniRef100_Q94A41	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alpha-amylase 3 n=1 Tax=Arabidopsis thaliana RepID=AMY3_ARATH	SoyBase	E_val: 1.00E-16	ISS

Expression Patterns of Glyma15g01911

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g01911 not represented in the dataset	Glyma15g01911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g01911 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g016000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g01911

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g01911

Limit To All Plant Sequences

>Glyma15g01911.1   sequence type=CDS   gene model=Glyma15g01911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCTGATTTTGGCCTTGCCAAGTTCTTGTACGACCCTGGCGCCTCTCAGTCCATGTCCTCCATTGCTGGCTCCTACGGCTACATTGCTCCAGGGGAGGGGCAACAAGAGTAGTGGAGACAATTTTCTTGCTGCTCCAAACATTGATCATTCACAGGACTTTGTGAGAAAGGATCTTAAAGAATGGTTATGCTGGATGAGGAACAATTTTGTGGAGAGATTGAGTCACATTTATGGAATGATTTCAAGCCAAAACTTCATAGGAGGTGATCATTGTATGACGTTAAAGGAAACAGACATAGAGTAA

Predicted protein sequences of Glyma15g01911

Limit To All Plant Sequences

>Glyma15g01911.1   sequence type=predicted peptide   gene model=Glyma15g01911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLILALPSSCTTLAPLSPCPPLLAPTATLLQGRGNKSSGDNFLAAPNIDHSQDFVRKDLKEWLCWMRNNFVERLSHIYGMISSQNFIGGDHCMTLKETDIE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain