SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g01900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g01900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g01900

Feature Type:gene_model
Chromosome:Gm15
Start:1259115
stop:1260526
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52240AT Annotation by Michelle Graham. TAIR10: RHO guanyl-nucleotide exchange factor 11 | chr1:19458844-19459235 REVERSE LENGTH=94 SoyBaseE_val: 2.00E-53ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0080147GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005875GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule associated complex SoyBaseN/AISS
GO:0005089GO-mf Annotation by Michelle Graham. GO Molecular Function: Rho guanyl-nucleotide exchange factor activity SoyBaseN/AISS
KOG3430 KOG Dynein light chain type 1 JGI ISS
PTHR11886Panther DYNEIN LIGHT CHAIN JGI ISS
PTHR11886:SF22Panther SUBFAMILY NOT NAMED JGI ISS
PF01221PFAM Dynein light chain type 1 JGI ISS
UniRef100_G7II18UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dynein light chain n=1 Tax=Medicago truncatula RepID=G7II18_MEDTR SoyBaseE_val: 1.00E-53ISS
UniRef100_I1MCQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCQ5_SOYBN SoyBaseE_val: 4.00E-63ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g01900 not represented in the dataset

Glyma15g01900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g43410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g015900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g01900.1   sequence type=CDS   gene model=Glyma15g01900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGAAGGTAAAGCTGTGATAGAGGATACTGACATGCCAGATAAGATGCAGATCCAAGCCATGGCATCCGCTTCTGAAGCTTTGGATCTCTATGATGTTTTTGATTGCACATCCATTGCTGCCCACATAAAAAAGGAGTTTGATACAAAGTATGGTTCTGGATGGCAGTGTGTGGTGGGATCAAGTTTTGGGTGTTTTTTCACCCATTCTAAGGGAACTTTCGTGTACTTTACTCTGGAGACTCTCAATTTCCTCATCTTCAAAGGGGCTTCTTATCTCATCTAA

>Glyma15g01900.1   sequence type=predicted peptide   gene model=Glyma15g01900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLEGKAVIEDTDMPDKMQIQAMASASEALDLYDVFDCTSIAAHIKKEFDTKYGSGWQCVVGSSFGCFFTHSKGTFVYFTLETLNFLIFKGASYLI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo