SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g01560

Feature Type:gene_model
Chromosome:Gm15
Start:1013163
stop:1016753
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g01560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15540AT Annotation by Michelle Graham. TAIR10: indole-3-acetic acid inducible 19 | chr3:5264100-5265378 FORWARD LENGTH=197 SoyBaseE_val: 7.00E-72ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009638GO-bp Annotation by Michelle Graham. GO Biological Process: phototropism SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0080086GO-bp Annotation by Michelle Graham. GO Biological Process: stamen filament development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF02309PFAM AUX/IAA family JGI ISS
UniRef100_I1MCL2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCL2_SOYBN SoyBaseE_val: 1.00E-133ISS
UniRef100_O24541UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 22C n=1 Tax=Vigna radiata var. radiata RepID=AX22C_VIGRR SoyBaseE_val: 8.00E-98ISS

Expression Patterns of Glyma15g01560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g01560
ParalogEvidenceComments
Glyma13g43780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g01560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g012800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g01560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g01560
>Glyma15g01560.1   sequence type=CDS   gene model=Glyma15g01560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAAGAAGGTGTTGGGCTTGAAATCACTACTGAGCTAAGGTTGGGCCTTCCCGGTGGGGAATTACCTGACAAGAACGAGAAGATGAAGAAGAGGGTGTTCTCGGAGATTAATCAAGGTGATGAAAACAGCTCCTCCGAAGAAGATCGCAAAATCCAAACCAAAAACCAAGTGGTTGGGTGGCCTCCGGTGTGTTCGTACCGCAAGAAGAACACCATCAATGAAACCAAAATGTACGTCAAAGTTAGCATGGACGGGGCTCCTTTCTTGCGTAAAATTGATTTGGCTATGCACAAGGGATATTCGGAGCTAGCCTTGGCCTTGGAGAAGTTCTTCGGTTGCTATGGAATTGGCTCAGCGTTGAAGGATGAGGAGAATGTTGAACAAGTTCCCATATACGAGGACAAAGATGGTGACTGGATGCTCGTTGGAGATGTTCCTTGGGAGATGTTTATTGAGTCATGCAAGAGGTTGAGGATTATGAAGAGATCAGATGCAAAGGGCTTCGATCTGCAACCAAAAGGGTCTTTAAAGGGATTTATAGAAGGCGTGACAAAATGA
Predicted protein sequences of Glyma15g01560
>Glyma15g01560.1   sequence type=predicted peptide   gene model=Glyma15g01560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKEGVGLEITTELRLGLPGGELPDKNEKMKKRVFSEINQGDENSSSEEDRKIQTKNQVVGWPPVCSYRKKNTINETKMYVKVSMDGAPFLRKIDLAMHKGYSELALALEKFFGCYGIGSALKDEENVEQVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFDLQPKGSLKGFIEGVTK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo