SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g01320

Feature Type:gene_model
Chromosome:Gm15
Start:807640
stop:808605
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g01320
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52690AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein (LEA) family protein | chr1:19619842-19620589 FORWARD LENGTH=169 SoyBaseE_val: 3.00E-11ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009830GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification involved in abscission SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MCI2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCI2_SOYBN SoyBaseE_val: 6.00E-67ISS
UniRef100_Q9XET0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Seed maturation protein PM30 n=1 Tax=Glycine max RepID=Q9XET0_SOYBN SoyBaseE_val: 2.00E-19ISS

Expression Patterns of Glyma15g01320
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g01320
ParalogEvidenceComments
Glyma13g44020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g01320 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g010500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g01320
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g01320
>Glyma15g01320.1   sequence type=CDS   gene model=Glyma15g01320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCCCATAGGCAAAGCTATGAAGCTGGTCAAACCAAGGGCCGAACTGAGGAAAAGACGAATCAGATGATGGGCAATAATGGGGAGAAGACTCAGGAAATAGCCCAAGCTGCAAAGGATAAGACCCAACAAACAGCCCAAGCTGCAAAGGAGAAGGCCCAACAGAATACAGACGAAGGAATCGGCCCAGTCAGGGAAGGACAACACCAAAGGGTTCCTGCAGCAGACAGGGGAGAAGGTGAAGGGCGCTGCCCAAGGTGCTACAGAGACTGTGAAGCAAACCCTTGGCTTGGGCCAGCATGA
Predicted protein sequences of Glyma15g01320
>Glyma15g01320.1   sequence type=predicted peptide   gene model=Glyma15g01320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASHRQSYEAGQTKGRTEEKTNQMMGNNGEKTQEIAQAAKDKTQQTAQAAKEKAQQNTDEGIGPVREGQHQRVPAADRGEGEGRCPRCYRDCEANPWLGPA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo