Report for Sequence Feature Glyma15g01260
Feature Type: gene_model
Chromosome: Gm15
Start: 761322
stop: 763652
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g01260
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G80180 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15400.3); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:30157057-30157473 REVER
SoyBase E_val: 9.00E-26 ISS
GO:0010375 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex patterning
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1MCH6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MCH6_SOYBN
SoyBase E_val: 2.00E-95 ISS
Expression Patterns of Glyma15g01260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g01260
Paralog Evidence Comments
Glyma13g44080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g01260 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g009900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g01260
Coding sequences of Glyma15g01260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g01260.1 sequence type=CDS gene model=Glyma15g01260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGGTCTTCAAAGATCTGCAGTGTCCTTCAGGAGGCAGGGTTCATCAGGCTTCGTTTGGGACGATAGGTTCTTACAAGAGGAATTGAACAAAGTCAAGGAAGATCACAACAACAACAACAACCACGACCACGACAACGATGACGGCGGTGAAATTAAAGAGCTTCAAGTTCAAACAACGCCGCCCCTCCAGAGAATCCGCTCCAACGGCGGAGCACGCGGCTACCGCACTGGAAAAGTTTCGCCGGCGATTGAGCCACCGTCTCCCAGGCTCTCTGCATGTGGCTTCTGCGCCGCCTTTGGAAAAGCAGGGGACAACAAGCATCGACCAAGGGATAGAAAACACAACGCAGGATATGAAGCCCAATTTTTGTGGTGGGCAATCACTCGTACTCCTAGCTAA
Predicted protein sequences of Glyma15g01260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g01260.1 sequence type=predicted peptide gene model=Glyma15g01260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAGLQRSAVSFRRQGSSGFVWDDRFLQEELNKVKEDHNNNNNHDHDNDDGGEIKELQVQTTPPLQRIRSNGGARGYRTGKVSPAIEPPSPRLSACGFCAAFGKAGDNKHRPRDRKHNAGYEAQFLWWAITRTPS*