SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g01210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g01210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g01210

Feature Type:gene_model
Chromosome:Gm15
Start:733231
stop:736258
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g01210
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34160AT Annotation by Michelle Graham. TAIR10: Alba DNA/RNA-binding protein | chr2:14426283-14427220 FORWARD LENGTH=130 SoyBaseE_val: 9.00E-64ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
PF01918PFAM Alba JGI ISS
UniRef100_C6T4F4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4F4_SOYBN SoyBaseE_val: 4.00E-89ISS
UniRef100_D7LGX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleic acid binding protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LGX9_ARALL SoyBaseE_val: 2.00E-60ISS

Expression Patterns of Glyma15g01210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g01210 not represented in the dataset
Glyma15g01210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g01210
ParalogEvidenceComments
Glyma13g44090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g01210 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g009400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g01210
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g01210
>Glyma15g01210.1   sequence type=CDS   gene model=Glyma15g01210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGACATAACAGAGGGAGTGAACAACATCAACATCTCTGATTCGTATAAGAAAAATCGCATTCAGGTCTCTAACACCAAGAAGCCCCTCTTCTTCTACGTTAATCTGGCCAAGAGATATATGCAACAGCATGATGAGGTCGAGCTCTCAGCTCTAGGAATGGCTATTGCCACAGTAGTAACTGTTGCTGAAATTTTGAAAAACAACAGACTTGCTGTTGAAAAGAAAATCAGGACATCAACTGTTGACATAAAGGATGACTCTAGAGGTCGACCTGTTCAAAAGGCCAAGATTGAAATAGTACTAGGGAAGACAGCAAACTTCGATGAGTTGATGGCTGCTGCAGCTGCTGAAGATGGTGAAAATGGAGATGTTGAAGAGCAGAGTGCATGA
Predicted protein sequences of Glyma15g01210
>Glyma15g01210.1   sequence type=predicted peptide   gene model=Glyma15g01210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDITEGVNNINISDSYKKNRIQVSNTKKPLFFYVNLAKRYMQQHDEVELSALGMAIATVVTVAEILKNNRLAVEKKIRTSTVDIKDDSRGRPVQKAKIEIVLGKTANFDELMAAAAAEDGENGDVEEQSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo