SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g01191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g01191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g01191

Feature Type:gene_model
Chromosome:Gm15
Start:719480
stop:721844
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52600AT Annotation by Michelle Graham. TAIR10: Peptidase S24/S26A/S26B/S26C family protein | chr1:19590612-19592486 FORWARD LENGTH=180 SoyBaseE_val: 2.00E-95ISS
GO:0006465GO-bp Annotation by Michelle Graham. GO Biological Process: signal peptide processing SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG3342 KOG Signal peptidase I JGI ISS
PTHR10806Panther PROTEASE FAMILY S26 MICROSOMAL SIGNAL PEPTIDASE SUBUNIT SPC18,21/SEC11(YEAST) JGI ISS
PF00717PFAM Peptidase S24-like JGI ISS
UniRef100_E6NUB9UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL06P13.9 protein n=1 Tax=Jatropha curcas RepID=E6NUB9_9ROSI SoyBaseE_val: 2.00E-95ISS
UniRef100_I1MSH9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MSH9_SOYBN SoyBaseE_val: 2.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g01191 not represented in the dataset

Glyma15g01191 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g009200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g01191.1   sequence type=CDS   gene model=Glyma15g01191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTTACGTCTGCACTGATCATATGGAAGGCATTGATGTGCATTACTGGCAGTGAATCTCCTGTTGTTGTTGTTCTTTCTGAAAGCATGGAACCCGGCTTCAAGCGGGGAGACATCTTATTCTTGCATATGAATCGAGATCCCATTCGGGCAGGGGAGATTGTTGTCTTTAATGTCGATGGACGTGAGATTCCAATTGTTCATCGTGTAATTATGGTACATGACAGGAAAGATACTGGGGAGGTTGATGTTCTCACGAAAGGAGACAAGAATGATGTGGATGACAGGCTACTGTATGTTCACGGTCAGCTTTGGCTGCAAAGGCACCACGTTATGGGTAGAGCTGTCGGGTTCTTACCTTACGTAGGCTGGGTGACCATCATTATGACTGAAAAGCCTATTATCAAGTATATTCTCATTAGTGCTTTGGGGCTGCTCGTGATAACTTCAAAAGATTAA

>Glyma15g01191.1   sequence type=predicted peptide   gene model=Glyma15g01191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVTSALIIWKALMCITGSESPVVVVLSESMEPGFKRGDILFLHMNRDPIRAGEIVVFNVDGREIPIVHRVIMVHDRKDTGEVDVLTKGDKNDVDDRLLYVHGQLWLQRHHVMGRAVGFLPYVGWVTIIMTEKPIIKYILISALGLLVITSKD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo