Glyma15g00570 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g00570

Feature Type:	gene_model
Chromosome:	Gm15
Start:	289709
stop:	291897
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g00570

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80840	AT	Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 40 \| chr1:30383834-30385356 FORWARD LENGTH=302	SoyBase	E_val: 7.00E-97	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0002237	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin	SoyBase	N/A	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0009595	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009646	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to absence of light	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0016045	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of bacterium	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043900	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process	SoyBase	N/A	ISS
GO:0050691	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response to virus by host	SoyBase	N/A	ISS
GO:0050776	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of immune response	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF03106	PFAM	WRKY DNA -binding domain	JGI		ISS
UniRef100_I1MCA9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCA9_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q2PJR9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WRKY27 n=1 Tax=Glycine max RepID=Q2PJR9_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma15g00570

Locus	Gene Symbol	Protein Name
	WRKY27	WRKY Transcription Factor

Expression Patterns of Glyma15g00570

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g00570

Paralog	Evidence	Comments
Glyma13g44730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g00570 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g003300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g00570

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g00570

Limit To All Plant Sequences

>Glyma15g00570.1   sequence type=CDS   gene model=Glyma15g00570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTCTCTCACTTCACAAACTTAATTTGAACCTCTCACCTTGCTCATCATCTGGAATTTATTTGGCAGTCATGGATTATTCATCATGGATTAACACTTCCTTGGATCTCAACATTAATCTCCATAGGGTTCACGAAGAACTTCCCAAAAAGCAGGTGGAAAACAATTTTTTCTCATTGGATTTGGAGGTGAAGAAATCTTCTGTAAAACAAGAGTCAGCAGGTGCCTTGGCGGAGGAACTGAAGCGGGTGAGTGCAGAAAACAAGAAGTTAACCGAAATGCTCACAGAGATGTGTGAGAACTACAACACTTTGCGAAGCAATTTGATGGAATACATGAGGAAGAATCCTGATAAGGAGCTCAGCTCATCAAGGAAAAGGAAGTCTGCAAGCAGCAACAACAATAGTACTATTCCAATGGGAGTCAACGGAACCTCTGAAAGCAGCTCAACCGATGAGGAATCCTGCAAGAATCCAAAGGAAGACATGAAGACAAAAATTTCAAGAGTTTATATGAGGACAGAAGCATCTGATACAAGCCTTATTGTGAAAGATGGATATCAATGGAGGAAATATGGACAAAAGGTGACCAGAGATAACCCTTCTCCAAGAGCATATTTCAAGTGCTCTTTTGCTCCAAGCTGCCCGGTCAAAAAGAAGGTGCAAAGAAGTGTGGATGATCAATCTGTTCTGGTTGCAACTTATGAAGGAGAGCACAATCATACACACCCTTCTCAAATGGAGGTAACAACAGGTTCCAACCGTTCAGTATCATGTTCAGCGTCTCTTAGCTCTTCCGCACCAACAGTTACCCTTGACTGGACAAAATCCAAGTCCAGCAGTGAGTCTAAGAATGTAAATCCCAAAACTGAATCACCAGAAGTCCCGCAGGTTTTGGTAGAACAGATGGCTACTTCCTTGACCAAGGATCCTAATTTCAGAGCAGCACTAGTTGCCGCCATCTCTGGAAAAATGTTGCACAATAATAATTAA

Predicted protein sequences of Glyma15g00570

Limit To All Plant Sequences

>Glyma15g00570.1   sequence type=predicted peptide   gene model=Glyma15g00570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLSLHKLNLNLSPCSSSGIYLAVMDYSSWINTSLDLNINLHRVHEELPKKQVENNFFSLDLEVKKSSVKQESAGALAEELKRVSAENKKLTEMLTEMCENYNTLRSNLMEYMRKNPDKELSSSRKRKSASSNNNSTIPMGVNGTSESSSTDEESCKNPKEDMKTKISRVYMRTEASDTSLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSVDDQSVLVATYEGEHNHTHPSQMEVTTGSNRSVSCSASLSSSAPTVTLDWTKSKSSSESKNVNPKTESPEVPQVLVEQMATSLTKDPNFRAALVAAISGKMLHNNN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain