SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g00550

Feature Type:gene_model
Chromosome:Gm15
Start:276266
stop:278043
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g00550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62640AT Annotation by Michelle Graham. TAIR10: 3-ketoacyl-acyl carrier protein synthase III | chr1:23192502-23194737 FORWARD LENGTH=404 SoyBaseE_val: 7.00E-143ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008610GO-bp Annotation by Michelle Graham. GO Biological Process: lipid biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004315GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-oxoacyl-[acyl-carrier-protein] synthase activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11877Panther HYDROXYMETHYLGLUTARYL-COA SYNTHASE JGI ISS
PTHR11877:SF13Panther JGI ISS
PF08541PFAM 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal JGI ISS
PF08545PFAM 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III JGI ISS
UniRef100_Q9M4R7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-ketoacyl-acyl carrier protein synthase III n=1 Tax=Glycine max RepID=Q9M4R7_SOYBN SoyBaseE_val: 2.00E-161ISS
UniRef100_UPI000233ABAEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ABAE related cluster n=1 Tax=unknown RepID=UPI000233ABAE SoyBaseE_val: 0ISS

Proteins Associated with Glyma15g00550
LocusGene SymbolProtein Name
KASIII-2 beta-ketoacyl-ACP synthetase 3 gene 2

Expression Patterns of Glyma15g00550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g00550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g003100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g00550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g00550
>Glyma15g00550.2   sequence type=CDS   gene model=Glyma15g00550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAATGCATCTGGGACTGGGTTCTTCACACTTTCTGTTGATTCTTCGAAAGTTGTTTGCTTTGGAAGCATCGCTGACAGACATGTGAGGAAAGGGTGCAAAGATAGTAGCTTGACTGGTTTAGCGGTAGAGGCTGCAAGGAAAGCTCTCGAGATGGCAAAGGTAGACCCTGCTCCACAGATTCCAATACAACTTGGCTGCAAAAAAAATCCATTGTCTTATGACATTACAGCTGCATGTAGTGGATTTCTGCTGGGTTTAATATCATCTTCTTGTCACATTAGGGGGGGTGGTTTTAATAATGTTCTAGTCATTGGAGCCGATGCTATTTCACGATATGTTGATTGGACAGATAGAGGCTCCTGTATTCTTTTTGGGGATGCTGCCGGTGCTGAACTAGTACAGGCCTGCAACATTGAGGAAGATGGTTTATTTGTTTTTGATTTGCATAGTGATGGCAGTGGCCAAAGGCACTTGAATGCTGCCATTAGAGAAAACGAGTCAAATAATCCATTGGATTCAAATGGTTCTGTTTTTGGCTTTCCTCCCAACCGGTCCCCATATTCATGCATTCAAATGAATGGGAAAGAAGTCTTTTGCTTTGCTGTAAGATGTGTACCACAATCAATTGAATTTGCCCTTGGAAAGGCTGGTCTCCCGGCATCTAGCATTGATTGGTTACTTCTACACCAGATTATCGATGCAGTTGCCGCTCGGTTAGAACTCCCCTCAGAACGGGTGATATCAAATTTGGCTAATAATAGTAACACAAGTGCAGCTTCCATTCCTTTGACTTTGGATGAAGCAGTTCGAAGCGGTAAAGTTAAGCCAGGGCAAACTATTGCAACTGCTGGCTTTGGCGCGGGTCTTACTTGGGGTTCGGCAATTGTTCGTTGGGGCTAA
Predicted protein sequences of Glyma15g00550
>Glyma15g00550.2   sequence type=predicted peptide   gene model=Glyma15g00550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANASGTGFFTLSVDSSKVVCFGSIADRHVRKGCKDSSLTGLAVEAARKALEMAKVDPAPQIPIQLGCKKNPLSYDITAACSGFLLGLISSSCHIRGGGFNNVLVIGADAISRYVDWTDRGSCILFGDAAGAELVQACNIEEDGLFVFDLHSDGSGQRHLNAAIRENESNNPLDSNGSVFGFPPNRSPYSCIQMNGKEVFCFAVRCVPQSIEFALGKAGLPASSIDWLLLHQIIDAVAARLELPSERVISNLANNSNTSAASIPLTLDEAVRSGKVKPGQTIATAGFGAGLTWGSAIVRWG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo