Glyma15g00430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g00430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g00430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g00430

Feature Type:	gene_model
Chromosome:	Gm15
Start:	210077
stop:	212149
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g00430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G79650	AT	Annotation by Michelle Graham. TAIR10: Rad23 UV excision repair protein family \| chr1:29972406-29975132 REVERSE LENGTH=371	SoyBase	E_val: 4.00E-98	ISS
GO:0006259	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA metabolic process	SoyBase	N/A	ISS
GO:0006284	GO-bp	Annotation by Michelle Graham. GO Biological Process: base-excision repair	SoyBase	N/A	ISS
GO:0006289	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide-excision repair	SoyBase	N/A	ISS
GO:0033044	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003684	GO-mf	Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding	SoyBase	N/A	ISS
GO:0043130	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin binding	SoyBase	N/A	ISS
GO:0070628	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proteasome binding	SoyBase	N/A	ISS
PTHR10621	Panther	UV EXCISION REPAIR PROTEIN RAD23	JGI		ISS
PF00627	PFAM	UBA/TS-N domain	JGI		ISS
PF09280	PFAM	XPC-binding domain	JGI		ISS
UniRef100_G7ZYZ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RAD23 protein n=3 Tax=Medicago truncatula RepID=G7ZYZ1_MEDTR	SoyBase	E_val: 8.00E-107	ISS
UniRef100_UPI000233C15E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C15E related cluster n=1 Tax=unknown RepID=UPI000233C15E	SoyBase	E_val: 1.00E-139	ISS

Expression Patterns of Glyma15g00430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g00430 not represented in the dataset	Glyma15g00430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g00430

Paralog	Evidence	Comments
Glyma13g44910	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g00430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g002000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g00430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g00430

Limit To All Plant Sequences

>Glyma15g00430.2   sequence type=CDS   gene model=Glyma15g00430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGTGACTACAGATACTTATGGTCAGGCTGCTTCAAATTTAGTTGCTGGTAGTAGTCTTGAGCAGACTATTCAGCAAATTATGGACCTGGGTGGTGGCAGTTGGGACAGAGATACAGTTAGTCGTGCTCTTCGAGCAGCTTACAATAACCCAAAGCGTGCTGTAGATTATTTATATTCTAGAATTCCTGAAGCAGCAGAAATTGCTGTGCCAGCTGCTCCTTACCCAATCAGTCAAACAACGGAAACAGGTGGGGTCACCGCCGGGGCTGTTTCTGGGTTTCAAGCATTACGCTCAATGGTGCAATCCAATCCACAAATTCTGCAGCCTGTACTTCAGGAACTTGGAAAGCAGAATCTTAGTCTCTCAAGACTTATTCAAGAGCATCATGGTGAATTTCTCCAGTTGATTAACGATCCTGTTGAGGGTTCTGAAGGTGATATATTTGATCAACCTGAGCAAGATATGCCTCATGCTATCAATGTGACGCCAGCGGAGCAGGAGGCAATTGGAAGGCTTGAGGCTATGGGATTTGATAGAGCCTCAGTCATCGAGGCATGTGACCGTGACGAGCAATTGGCAGCCAACTACTTACTGGAAAATGCTGGAGATTTTGAGGATTAA

Predicted protein sequences of Glyma15g00430

Limit To All Plant Sequences

>Glyma15g00430.2   sequence type=predicted peptide   gene model=Glyma15g00430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNVTTDTYGQAASNLVAGSSLEQTIQQIMDLGGGSWDRDTVSRALRAAYNNPKRAVDYLYSRIPEAAEIAVPAAPYPISQTTETGGVTAGAVSGFQALRSMVQSNPQILQPVLQELGKQNLSLSRLIQEHHGEFLQLINDPVEGSEGDIFDQPEQDMPHAINVTPAEQEAIGRLEAMGFDRASVIEACDRDEQLAANYLLENAGDFED*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain