SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g00311

Feature Type:gene_model
Chromosome:Gm15
Start:115339
stop:116858
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46915AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3754) | chr2:19274018-19277707 REVERSE LENGTH=708 SoyBaseE_val: 2.00E-39ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000233F491UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F491 related cluster n=1 Tax=unknown RepID=UPI000233F491 SoyBaseE_val: 8.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g00311 not represented in the dataset

Glyma15g00311 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g45030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g001000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g00311.1   sequence type=CDS   gene model=Glyma15g00311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTTCTTTCAAATGCACAATTTGAAGAACTATCAGCTAGGGACCTGATGTTAACGTCTGCATTGAACACAGACTATCTCCTTACCTTGCCAACGTATGTTGATTGGAAGAGAGCGTATGAGTCTAATGCCATAATATTTAGGCGTGGTTACGCAACTGAGAAGCAGAAGGGTCTATTATTAATTGTGGAAAAACTGGATTACTTACAGTCTAAGCTTCTACGAAGGACCTTCTTTTCTATATCAAAACCACTAACAAAACTTGGCACCTGGATGAGCGAGGTTATATTTTTGTGGTAG

>Glyma15g00311.1   sequence type=predicted peptide   gene model=Glyma15g00311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLLSNAQFEELSARDLMLTSALNTDYLLTLPTYVDWKRAYESNAIIFRRGYATEKQKGLLLIVEKLDYLQSKLLRRTFFSISKPLTKLGTWMSEVIFLW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo