SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g40430

Feature Type:gene_model
Chromosome:Gm14
Start:49367208
stop:49369394
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g40430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47830AT Annotation by Michelle Graham. TAIR10: SNARE-like superfamily protein | chr1:17613346-17614784 REVERSE LENGTH=142 SoyBaseE_val: 1.00E-94ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0030125GO-cc Annotation by Michelle Graham. GO Cellular Compartment: clathrin vesicle coat SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
KOG0935 KOG Clathrin adaptor complex, small subunit JGI ISS
PTHR11753Panther CLATHRIN COAT ASSEMBLY PROTEIN JGI ISS
PF01217PFAM Clathrin adaptor complex small chain JGI ISS
UniRef100_B7FMB2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AP-2 complex subunit sigma-1 n=1 Tax=Medicago truncatula RepID=B7FMB2_MEDTR SoyBaseE_val: 7.00E-97ISS
UniRef100_C6T1J5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1J5_SOYBN SoyBaseE_val: 2.00E-97ISS

Expression Patterns of Glyma14g40430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g40430
ParalogEvidenceComments
Glyma17g37730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g40430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g218900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g40430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g40430
>Glyma14g40430.2   sequence type=CDS   gene model=Glyma14g40430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCCGATTCATTCTGTTGCAGAACAGGCAGGGCAAGACCCGTCTTGCCAAATACTACGTTCCTCTCGAGGATTCCGAGAAGCACAAGGTGGAATACGAGGTTCACCGCCTCGTCGTAAACAGAGACCCTAAATACACAAATTTCGTCGAGTTTCGTACGCACAAGATAATATACAGGCGATATGCTGGGTTGTTTTTCTCAATCTGTGTTGATATCACTGATAATGAGTTGGCGTATTTAGAGTGCATCCATTTGTTTGTGGAAATATTGGATCACTTCTTCAGCAATGTCTGTGAGCTTGATTTGGTTTTTAACTTCCACAAGGTCTATCTTATACTTGATGAATTCATTCTAGCGGGTGAACTGCAAGAAACAAGCAAGAAGGCTATTATTGAGAGAATGGGGGAACTGGAAAAACTAGAATGA
Predicted protein sequences of Glyma14g40430
>Glyma14g40430.2   sequence type=predicted peptide   gene model=Glyma14g40430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKYTNFVEFRTHKIIYRRYAGLFFSICVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILAGELQETSKKAIIERMGELEKLE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo