SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g40400

Feature Type:gene_model
Chromosome:Gm14
Start:49354449
stop:49355605
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g40400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75750AT Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 1 | chr1:28441813-28442284 REVERSE LENGTH=97 SoyBaseE_val: 4.00E-32ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_C6SWR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWR9_SOYBN SoyBaseE_val: 4.00E-63ISS
UniRef100_G7I774UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7I774_MEDTR SoyBaseE_val: 5.00E-48ISS

Expression Patterns of Glyma14g40400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g40400
ParalogEvidenceComments
Glyma17g37760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g40400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g219100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g40400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g40400
>Glyma14g40400.1   sequence type=CDS   gene model=Glyma14g40400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCTCTCTAAGCTTATAGTTGCTTCCCTTCTTGCCTCGCTTCTCCTTCTTCATCTTGTTGATGCTGATCAATCGGCACATGTACAAACGCAGGGGTCTCTTCTGCAGAAGATAGATTGTAATGGAGCATGTGCTGCGAGGTGTCGTTTATCATCTCGGCCACGTCTCTGCAAAAGAGCCTGTGGAACTTGTTGTAGACGCTGCAACTGCGTGCCACCTGGCACTGCTGGAAACCAAGAAGTGTGTCCCTGCTATGCTAGTTTGACTACTCATGGTGGCAAACGCAAGTGCCCTTAG
Predicted protein sequences of Glyma14g40400
>Glyma14g40400.1   sequence type=predicted peptide   gene model=Glyma14g40400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLSKLIVASLLASLLLLHLVDADQSAHVQTQGSLLQKIDCNGACAARCRLSSRPRLCKRACGTCCRRCNCVPPGTAGNQEVCPCYASLTTHGGKRKCP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo