SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g40130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g40130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g40130

Feature Type:gene_model
Chromosome:Gm14
Start:49118081
stop:49123556
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G20200AT Annotation by Michelle Graham. TAIR10: PAM domain (PCI/PINT associated module) protein | chr1:7001409-7004154 REVERSE LENGTH=488 SoyBaseE_val: 0ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042176GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein catabolic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008541GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, lid subcomplex SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0030234GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity SoyBaseN/AISS
KOG2581 KOG 26S proteasome regulatory complex, subunit RPN3/PSMD3 JGI ISS
PTHR10758Panther 26S PROTEASOME REGULATORY SUBUNIT S3 JGI ISS
PTHR10758:SF2Panther 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 3 JGI ISS
PF01399PFAM PCI domain JGI ISS
PF08375PFAM Proteasome regulatory subunit C-terminal JGI ISS
UniRef100_G7J5U6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S proteasome non-ATPase regulatory subunit n=1 Tax=Medicago truncatula RepID=G7J5U6_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1MC13UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MC13_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g40130 not represented in the dataset

Glyma14g40130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g38000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g221600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g40130.1   sequence type=CDS   gene model=Glyma14g40130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGAAGACGAGGAGATGAAAGATCAGGCAACGCCTTCACACTTGCTTTCTTCAGTTCCTCCATCTACATTGCACCATTTGAAGGGAATAGCATCAATTATTGAAACCGGTTCGTACTCAAAGGAAGTTCGTCGAATTGCTCGTGCCCTGCGCCTTACATTTGCATTTAGGCGTAAATTGACAACACCAGTTCTCTCATCTTTTCTTGATTATGTTCTTACTCCCGCTTCTGAACCTCACACTAGGTTATCCTCTTATCTCCCTAATCCTAAGGAGGGTGATCGAGAGATGGAAGTGGACAGTGCAACATCTACTATTCAAACCCTGGCGGCGAAGCACTTGTTGCCTGAGCTAGAAATCTACTGTTACCTCCTTGTCCTTCTTTTTCTGATTGACCAGAAAAGATACGATGCGGCCAAAGCTTGTTCCTCAGCAAGCATTGTTCGGCTGAAGAGCCTGAATAGAAGAACTGTCGATGTTATTGCATCTAGACTGTACTTTTATTACTCATATAGCTATGAGCTTACAGGAAATCTTGCTGAAATTCGAGGCAACCTCCTTGCATTGCACCGGATTGCTACCCTGCGTCATGATGAGCTGGGTCAGGAAACCCTTCTGAATCTGTTACTTCGTAACTATCTACATTACAACCTATATGATCAGGCAGAGAAGTTGAGGTCCAAGGCTCCACGTTTTGAGGCACATTCAAACCAGCAGTTCTGTCGTTATCTCTTCTACCTTGGGAAAATTCGGACAATTCAGTTGGAGTACACAGATGCAAAAGAGTCACTCTTGCAGGCTGCTCGTAAAGCTCCCAGTGCAGCACAGGGTTTTCGGATTCAATGTAACAAGTGGGCTGTGATAGTGCGTTTATTATTGGGAGAAATACCTGAGAGGACCGTCTTTATGCAGAGAGGAATGGAGAAAGCTTTGAGGCCTTACTTTGAGCTTACTAATGCTGTCCGGATTGGTGACTTGGAGCTATTTAGGAATGTTGCAGAGAAGTTTGGTACTACTTTCAATAGAGACCGAACTCATAATTTGATTGTTCGGCTCCGTCATAATGTCATCCGGACTGGTTTACGCAACATCAGCATATCATATTCACGCATCTCGCTAGTTGATGTAGCTAAAAAGTTGAGGTTGAACTCTGCAAGTCCTGTTGCTGACGCTGAGAGCATTGTAGCAAAGGCTATCCGTGATGGGGCTATTGATGCTTCATTGGATCATGCCAATGGGTGGATGGTATCCAAGGAAACTGGAGATATCTACTCTACAAATGAGCCTCAGTTGGCATTTAATTCTCGGATTGCCTTTTGTCTTAACATGCACAATGAGGCAGTTCGAGCACTGCGTTTTCCACCAAACACACAGAAGGAAAAGGAAAGTGCTGAGAAGAGGAGAGAGAGGCATCAACAAGAGCAAGAATTGGCTAAACATATCGCAGAGGAAGATGATGATGACTTTTGA

>Glyma14g40130.1   sequence type=predicted peptide   gene model=Glyma14g40130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEDEEMKDQATPSHLLSSVPPSTLHHLKGIASIIETGSYSKEVRRIARALRLTFAFRRKLTTPVLSSFLDYVLTPASEPHTRLSSYLPNPKEGDREMEVDSATSTIQTLAAKHLLPELEIYCYLLVLLFLIDQKRYDAAKACSSASIVRLKSLNRRTVDVIASRLYFYYSYSYELTGNLAEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPSAAQGFRIQCNKWAVIVRLLLGEIPERTVFMQRGMEKALRPYFELTNAVRIGDLELFRNVAEKFGTTFNRDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLNSASPVADAESIVAKAIRDGAIDASLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTQKEKESAEKRRERHQQEQELAKHIAEEDDDDF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo