Glyma14g39800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g39800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g39800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g39800

Feature Type:	gene_model
Chromosome:	Gm14
Start:	48887731
stop:	48887865
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g39800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG01080	AT	Annotation by Michelle Graham. TAIR10: mitochondrial F0-ATPase subunit 9 \| chrM:278895-279152 FORWARD LENGTH=85	SoyBase	E_val: 2.00E-12	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005753	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex	SoyBase	N/A	ISS
GO:0033177	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain	SoyBase	N/A	ISS
GO:0045263	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, coupling factor F(o)	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
PTHR10031	Panther	ATP SYNTHASE 9 MITOCHONDRIAL	JGI		ISS
PF00137	PFAM	ATP synthase subunit C	JGI		ISS
UniRef100_Q0MVI1	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP synthase subunit 9, mitochondrial n=3 Tax=Silene RepID=Q0MVI1_9CARY	SoyBase	E_val: 1.00E-18	ISS
UniRef100_Q0MVI1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit 9, mitochondrial n=3 Tax=Silene RepID=Q0MVI1_9CARY	SoyBase	E_val: 1.00E-18	ISS

Expression Patterns of Glyma14g39800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g39800 not represented in the dataset	Glyma14g39800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g39800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g39800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g39800

Limit To All Plant Sequences

>Glyma14g39800.1   sequence type=CDS   gene model=Glyma14g39800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAGAAGGTGCAAAATCAATAGGTGCCGGAGCTGCTACAATTGCCTCAGCGGGAGCTGCTGTAGGTATTGGAAACGTATTCAGTTCATTAATTCATTCCATGGCAAGAAATCCATCATTGGCAAAAAAATAA

Predicted protein sequences of Glyma14g39800

Limit To All Plant Sequences

>Glyma14g39800.1   sequence type=predicted peptide   gene model=Glyma14g39800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLEGAKSIGAGAATIASAGAAVGIGNVFSSLIHSMARNPSLAKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain