Glyma14g38030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g38030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g38030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g38030

Feature Type:	gene_model
Chromosome:	Gm14
Start:	47249340
stop:	47252691
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g38030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30260	AT	Annotation by Michelle Graham. TAIR10: U2 small nuclear ribonucleoprotein B \| chr2:12905557-12907434 REVERSE LENGTH=232	SoyBase	E_val: 2.00E-128	ISS
GO:0000354	GO-bp	Annotation by Michelle Graham. GO Biological Process: cis assembly of pre-catalytic spliceosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005654	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoplasm	SoyBase	N/A	ISS
GO:0005686	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: U2 snRNP	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0015030	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Cajal body	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
KOG4206	KOG	Spliceosomal protein snRNP-U1A/U2B	JGI		ISS
PTHR10501	Panther	SMALL NUCLEAR RIBONUCLEOPROTEIN U1A,U2B	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_C6TN69	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TN69_SOYBN	SoyBase	E_val: 4.00E-172	ISS
UniRef100_G7K5T4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: U1 small nuclear ribonucleoprotein A n=2 Tax=Medicago truncatula RepID=G7K5T4_MEDTR	SoyBase	E_val: 1.00E-141	ISS

Expression Patterns of Glyma14g38030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g38030 not represented in the dataset	Glyma14g38030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g38030

Paralog	Evidence	Comments
Glyma02g39890	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g38030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g200400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g38030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g38030

Limit To All Plant Sequences

>Glyma14g38030.1   sequence type=CDS   gene model=Glyma14g38030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCTCAGGGGATATACCTCCAAATCAGACCATTTACATCAAAAATATCAATGAGAAGGTCAAGAAAGATGAATTGAAGAGATCTCTGTATTGCTTATTCTCTCAATATGGAAGAATTTTGGATGTTATTGCTCTGAAGACACCCAAGCTTCGGGGACAGGCGTGGGTTTGTTTCAGTGAAGTCACTGCTGCAAGCAATGCAGTGCGACAAATGCAAAACTTCCCTTTCTATGACAAACCTATGAGAATTCAATATGCAAAAACAAAATCAGACTGTATTGCAAAAGAAGAGGGTACTTATGTTCCAAGGGAAAAGAAGAAGAAACAAGAGGAGAAAGCTGAAAGAAAGCGGCGTGCTGAGGAAGCACAACAATCTGGGGTGGCCAATGGAACACATAGTGCAAGTAATGGTGGTCCAACTGCATCATTCCGTCAAGGACCTGGTGCTCAAGAAACAGCTGCTCCTAACAATATTTTGTTCATAGAGAATTTGCCTCATGAAACTACTGGTAGGATGCTTGAAATGCTCTTCGAACAATACCCAGGTTTTAAGGAAGTGCGCTTGATTGAAGCAAAGCCAGGTATCGCATTTGTTGATTTTGAAGATGAGGTGCAATCGTCCATGGCCATGCAAGCTCTTCATGGCTTCAAAATCACCCCTCAGAATCCCATGATTATAACCTTTGCTAAGAAGTAG

Predicted protein sequences of Glyma14g38030

Limit To All Plant Sequences

>Glyma14g38030.1   sequence type=predicted peptide   gene model=Glyma14g38030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSGDIPPNQTIYIKNINEKVKKDELKRSLYCLFSQYGRILDVIALKTPKLRGQAWVCFSEVTAASNAVRQMQNFPFYDKPMRIQYAKTKSDCIAKEEGTYVPREKKKKQEEKAERKRRAEEAQQSGVANGTHSASNGGPTASFRQGPGAQETAAPNNILFIENLPHETTGRMLEMLFEQYPGFKEVRLIEAKPGIAFVDFEDEVQSSMAMQALHGFKITPQNPMIITFAKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain