SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g37534): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g37534): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g37534

Feature Type:gene_model
Chromosome:Gm14
Start:46830427
stop:46832788
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16720AT Annotation by Michelle Graham. TAIR10: TOXICOS EN LEVADURA 2 | chr3:5692880-5693794 FORWARD LENGTH=304 SoyBaseE_val: 2.00E-24ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG4172 KOG Predicted E3 ubiquitin ligase JGI ISS
PTHR14155Panther RING FINGER PROTEIN 6/12/38 JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7K734UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING-H2 zinc finger protein n=1 Tax=Medicago truncatula RepID=G7K734_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_I1MBD5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MBD5_SOYBN SoyBaseE_val: 3.00E-116ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g37534 not represented in the dataset

Glyma14g37534 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g39400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g195900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g37534.1   sequence type=CDS   gene model=Glyma14g37534   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGACTCAAACCGAGTCACCCAGCAACTCACTGAGTCAACTCGCTGAGAACATGTTCTCCGACAACAACCGCAACATCATGCTCGCAGCAATTATTTTCTTGCTCCTAGTTATCCTCTTCGTCCTCCTACTCCATGTGTACGCCAAATGGTTCTTATTCCAGGTACAATCACGTTCCCAGACTCGGCGGCGGCGAACTCCGGTGACCGTCTCCGGCGTTCTGGAACCTTCCCATTTCCACAGCATCAACATAGAAGCCTCACCCACGTGCTCCAAAGGCCTTGATTCGGCCACACTTTCGGCGATTCCCTTGTTTGTGCAAGGACCAGAGAAAACAGAGGAAACGGAGGAATTGGAATGTGTCATTTGCTTGAGCGTTATTGAGGAGGGTGAGATAGGAAGGAGATTGCCGAAGTGTGGCCACGCTTTTCACATGGAGTGCATTGATATGTGGTTGAGTTTACATTGCAATTGTCCAATTTGTAGAGCTCCTATTGTTGTTAGTGGCGATTCTCATTTGGGTTCTGTTGATGGTGATAGTGATGGTGTGGTTGAGATTGGGGTTGTTACACCGGGTTATGAGATTAGTGGGAGTGAACATGGTGGGGTGAGTGGTTCTGTTCCTGAAGCTTCTTCATCTTTGTTGGGTTTCTCTCTGAAGAGATTGCTGAGTAAGGTTTTTCTGTCACCTGATCATGTAACTGAATTGGATGGTTCACATTGA

>Glyma14g37534.1   sequence type=predicted peptide   gene model=Glyma14g37534   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPTQTESPSNSLSQLAENMFSDNNRNIMLAAIIFLLLVILFVLLLHVYAKWFLFQVQSRSQTRRRRTPVTVSGVLEPSHFHSINIEASPTCSKGLDSATLSAIPLFVQGPEKTEETEELECVICLSVIEEGEIGRRLPKCGHAFHMECIDMWLSLHCNCPICRAPIVVSGDSHLGSVDGDSDGVVEIGVVTPGYEISGSEHGGVSGSVPEASSSLLGFSLKRLLSKVFLSPDHVTELDGSH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo