SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g36760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g36760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g36760

Feature Type:gene_model
Chromosome:Gm14
Start:46053404
stop:46055593
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g36760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04635AT Annotation by Michelle Graham. TAIR10: ribonuclease P family protein / Rpp14 family protein | chr1:1291350-1291805 FORWARD LENGTH=151 SoyBaseE_val: 5.00E-71ISS
GO:0008033GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA processing SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0004526GO-mf Annotation by Michelle Graham. GO Molecular Function: ribonuclease P activity SoyBaseN/AISS
GO:0004540GO-mf Annotation by Michelle Graham. GO Molecular Function: ribonuclease activity SoyBaseN/AISS
KOG4639 KOG RNase P/RNase MRP subunit POP5 JGI ISS
PTHR10993Panther LIPOATE-PROTEIN LIGASE B JGI ISS
PTHR10993:SF1Panther LIPOATE-PROTEIN LIGASE B JGI ISS
PF01900PFAM Rpp14/Pop5 family JGI ISS
UniRef100_B9RHJ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lipoate-protein ligase B, putative n=1 Tax=Ricinus communis RepID=B9RHJ9_RICCO SoyBaseE_val: 3.00E-76ISS
UniRef100_C6T5D2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5D2_SOYBN SoyBaseE_val: 6.00E-111ISS

Expression Patterns of Glyma14g36760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g36760 not represented in the dataset
Glyma14g36760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g36760
ParalogEvidenceComments
Glyma02g38570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g36760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g188600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g36760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g36760
>Glyma14g36760.1   sequence type=CDS   gene model=Glyma14g36760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGGGTTCAGAAACAGATACATGGTGATGGAGGTTTTTCTGAACCCTAATAGAGACAAAGTTGGGGATGCGTCTGTTATAATTACACAGTTTAATGTGTCAAAAGCTGTAAGAGACAGCATATTGGTGAATTTTGGGGAGTGTGGTTTGGCTTCATCATTGGGATCGTTCCAGGTTAAGTACGTGAATCCAATCACTAATGTGTGTATAATTAGGGCATCAAGGGAGGAGTATCAGAAAGTATGGGCTGCCATTACAATGGTCACAAATATTGGAAACTGCCCGGTCATGTTTAACTTGCTGGATTTATCTGGAAGTATAAGGGCTTGTAAAAATGCTGCCTTGAAGTGTGAGGAGTCAAAATTTGAGCAGTACAAACTCATGCTTGGTGATCGATTCTCTGCCGATCATACTCATCGCATGAATACCTATCTCGACCGGATCAAAGTTTTGGAGCACTGA
Predicted protein sequences of Glyma14g36760
>Glyma14g36760.1   sequence type=predicted peptide   gene model=Glyma14g36760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGFRNRYMVMEVFLNPNRDKVGDASVIITQFNVSKAVRDSILVNFGECGLASSLGSFQVKYVNPITNVCIIRASREEYQKVWAAITMVTNIGNCPVMFNLLDLSGSIRACKNAALKCEESKFEQYKLMLGDRFSADHTHRMNTYLDRIKVLEH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo