Glyma14g35710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35710

Feature Type:	gene_model
Chromosome:	Gm14
Start:	44760509
stop:	44764834
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g35710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14600	AT	Annotation by Michelle Graham. TAIR10: Target SNARE coiled-coil domain protein \| chr4:8376562-8378078 FORWARD LENGTH=137	SoyBase	E_val: 4.00E-67	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3385	KOG	V-SNARE	JGI		ISS
PTHR12791	Panther	GOLGI SNARE BET1-RELATED	JGI		ISS
PTHR12791:SF17	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF05739	PFAM	SNARE domain	JGI		ISS
UniRef100_C6T099	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T099_SOYBN	SoyBase	E_val: 5.00E-93	ISS
UniRef100_G7KBG1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bet1-like protein n=1 Tax=Medicago truncatula RepID=G7KBG1_MEDTR	SoyBase	E_val: 4.00E-79	ISS

Expression Patterns of Glyma14g35710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35710 not represented in the dataset	Glyma14g35710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g35710

Paralog	Evidence	Comments
Glyma02g37440	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g35710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g179100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g35710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g35710

Limit To All Plant Sequences

>Glyma14g35710.1   sequence type=CDS   gene model=Glyma14g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCTAATTCCCACAGATTGGGTTCTTCCTACGGCGGCGCTGCCCCTTACCGATCAAGAGATGGGCTTAGCACCCGTCCCGTTGGTGCCTCGGAGGAGATCCAATTGCGAATTGATCCCCTGGACTTGGACGATGAGATCACCGGTCTTCATCGCCAAGTTAGAAGGTTGAAACATGTTGCTGAGGAGATAGGAACAGAAGTGAAGTATCAGAAAACTTTTCTTGAAGAACTGCAAATGACAATGATAAAGGCTCAAGCTGGAGTGAAGAATAACTTAAGAAGATTGAACAAGAGCATCGTCCAAAGTGGTTCAAACCATATTATTCATGTTATTATTTTTGCTTTAGTCTGTTTCTTTGTAGTATACCTTTGGTCCAAGATGTTCAGAAAGTGA

Predicted protein sequences of Glyma14g35710

Limit To All Plant Sequences

>Glyma14g35710.1   sequence type=predicted peptide   gene model=Glyma14g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAANSHRLGSSYGGAAPYRSRDGLSTRPVGASEEIQLRIDPLDLDDEITGLHRQVRRLKHVAEEIGTEVKYQKTFLEELQMTMIKAQAGVKNNLRRLNKSIVQSGSNHIIHVIIFALVCFFVVYLWSKMFRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain