SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g35601

Feature Type:gene_model
Chromosome:Gm14
Start:44606521
stop:44611326
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g35601
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02820AT Annotation by Michelle Graham. TAIR10: zinc knuckle (CCHC-type) family protein | chr3:611573-613294 FORWARD LENGTH=282 SoyBaseE_val: 6.00E-24ISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0007049GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0048478GO-bp Annotation by Michelle Graham. GO Biological Process: replication fork protection SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR13220Panther TIMELESS INTERACTING-RELATED JGI ISS
PTHR13220:SF1Panther gb def: mitotic phosphoprotein 67 [xenopus laevis] JGI ISS
PF00098PFAM Zinc knuckle JGI ISS
UniRef100_G7JPI7UniRef Annotation by Michelle Graham. Most informative UniRef hit: TIMELESS-interacting protein n=1 Tax=Medicago truncatula RepID=G7JPI7_MEDTR SoyBaseE_val: 2.00E-34ISS
UniRef100_UPI000233D86FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D86F related cluster n=1 Tax=unknown RepID=UPI000233D86F SoyBaseE_val: 5.00E-45ISS

Expression Patterns of Glyma14g35601
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35601 not represented in the dataset
Glyma14g35601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35601 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g178300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g35601
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g35601
>Glyma14g35601.1   sequence type=CDS   gene model=Glyma14g35601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTCTTTGTAACACTCAACCTCTCCTCTCACTCACGCCTAAGGTTCTTCGAGTCCTTCTGTTCGTCGTTGTCGCATTGCGCTCGAGACCCTAGAAGAGAAAAAATGGAGGGAACAAGAGCAGGAACCGCAACAGGGTCTTACAAGTGTGGCAAACCTGGTCACTGGTTACGAGATTGCCCTTTCTCCGCTCCCAATTCCAATTTCAATCTCAATCCAAACCCTAACTCTATCACCGCCACCACTCCCAATCCCAATACTCCAAATCGTTCTTCGTCTTCTTTCAAGCCCAAATCCGCCACCAAAAAGCCCAACATGCTCCCTCGAACAAAACCCAAACTCACACCGGAGCTTCTTCTCTCCGACGACGACCTCGGTTACGCCCTTCGCTATTTCCCTCGCAAGTTCAAATACTGTGGTCGTGGCCACGAGTTTGTTCACAAAGTAGAGAAAGTTGCTGCTACAAGGCGTGGAAAGTCTATGGATATTCTTCAGGTGCTAGTGGAAAGTGGAACAAGTGAGACTCTGCTCATATCTTATGCTTATTTCATATTTCTGTACAGAGCTATCTATGTAAAGTCTATTCTGCGTGTGTTTTTTCCTCTAATTTTGTTGGTTTGGCACATCAAGAAAGACACACGAGGAGCTATGAGCTGTCTCCATTGCCTATGGACATGTGCTTCTAAGTCAGGACATAATAGTTGCTGGAATGAGAACATGCAGAGATGCAATTGCTAG
Predicted protein sequences of Glyma14g35601
>Glyma14g35601.1   sequence type=predicted peptide   gene model=Glyma14g35601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLFVTLNLSSHSRLRFFESFCSSLSHCARDPRREKMEGTRAGTATGSYKCGKPGHWLRDCPFSAPNSNFNLNPNPNSITATTPNPNTPNRSSSSFKPKSATKKPNMLPRTKPKLTPELLLSDDDLGYALRYFPRKFKYCGRGHEFVHKVEKVAATRRGKSMDILQVLVESGTSETLLISYAYFIFLYRAIYVKSILRVFFPLILLVWHIKKDTRGAMSCLHCLWTCASKSGHNSCWNENMQRCNC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo