SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35530

Feature Type:gene_model
Chromosome:Gm14
Start:44479240
stop:44480962
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g35530
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72230AT Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein | chr1:27188287-27189093 FORWARD LENGTH=181 SoyBaseE_val: 5.00E-43ISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_C6SZ91UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ91_SOYBN SoyBaseE_val: 3.00E-139ISS
UniRef100_G7J401UniRef Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein n=1 Tax=Medicago truncatula RepID=G7J401_MEDTR SoyBaseE_val: 2.00E-57ISS

Expression Patterns of Glyma14g35530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35530 not represented in the dataset
Glyma14g35530 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g35530
ParalogEvidenceComments
Glyma02g37210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g35530 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g177600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g35530
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g35530
>Glyma14g35530.1   sequence type=CDS   gene model=Glyma14g35530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCTCTGTTGCTTTAGTTTTGGGTCTATGTCTAGCACTCAACATGGTTCTGCCGACACGTGCAGCTACCCACACAGTGGGAGACACCTCAGGTTGGGCACTCGGTGCTGATTACAGTACATGGGCCAGTGGCTTGAAATTGAAAGTCGGAGATAGTCTTGTTTTCAATTATGGGGCTGGTCACACAGTGGACGAAGTGAAAGAAAGTGATTACAAGAGCTGCACCACAGGCAATTCACTAAGCACAGACAGCAGTGGCACCACCACAATCACCCTCAAGACTGCCGGCACTCACTACTTCATATGTGCTTCTCCTGGCCATTGTGATGGTGGTATGAAGCTTGCTGTTAAAGTAAAGGCTAAAAAAGCATCTGCTCCTGCTACAGCACCTTCACCAGCTGCAAAGGACTCACCTTCTGATTCTGATGACACCAAAGACACACCCACTTCCACCTCCACTAACCCTAAAACTTCAACCTCCACCACCCCTTCAACTGAAACCTCCACCACTACCACATCTTCTTATACATCATCTGCAACTGCTGCTGGCTCCCCAATTGTTGCTATGTTTTTTGCTTCTTTGATCCCATACTTTGTGTTGCGTTTGATGTGA
Predicted protein sequences of Glyma14g35530
>Glyma14g35530.1   sequence type=predicted peptide   gene model=Glyma14g35530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSVALVLGLCLALNMVLPTRAATHTVGDTSGWALGADYSTWASGLKLKVGDSLVFNYGAGHTVDEVKESDYKSCTTGNSLSTDSSGTTTITLKTAGTHYFICASPGHCDGGMKLAVKVKAKKASAPATAPSPAAKDSPSDSDDTKDTPTSTSTNPKTSTSTTPSTETSTTTTSSYTSSATAAGSPIVAMFFASLIPYFVLRLM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo