SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g35486

Feature Type:gene_model
Chromosome:Gm14
Start:44452022
stop:44454799
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g35486
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G01770AT Annotation by Michelle Graham. TAIR10: HEAT repeat ;WD domain, G-beta repeat protein protein | chr5:294539-301773 REVERSE LENGTH=1336 SoyBaseE_val: 9.00E-16ISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR12848Panther FAMILY NOT NAMED JGI ISS
UniRef100_D7SR28UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7SR28_VITVI SoyBaseE_val: 6.00E-15ISS
UniRef100_G7KW32UniRef Annotation by Michelle Graham. Most informative UniRef hit: Regulatory-associated protein of mTOR n=1 Tax=Medicago truncatula RepID=G7KW32_MEDTR SoyBaseE_val: 1.00E-14ISS

Expression Patterns of Glyma14g35486
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35486 not represented in the dataset
Glyma14g35486 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35486 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g35486
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g35486
>Glyma14g35486.1   sequence type=CDS   gene model=Glyma14g35486   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATTGCCCTCAGGGTATGCTCATCATTGTTTGCACTGAGGGATAATAACTCCTTGTATATCATGGATATACTGGAATCCATAGTTCACCAGTGCAAGATGAAGACTGAATGTGTAGCTCTAGTATTATGTTTAAACATTAGTGTCGATCCTCCAGATGTAATAAAGATATCCCCTTGTGCCAGAATGGAGTGCTGGATAGGAAGATAA
Predicted protein sequences of Glyma14g35486
>Glyma14g35486.1   sequence type=predicted peptide   gene model=Glyma14g35486   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQIALRVCSSLFALRDNNSLYIMDILESIVHQCKMKTECVALVLCLNISVDPPDVIKISPCARMECWIGR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo