Glyma14g35440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35440

Feature Type:	gene_model
Chromosome:	Gm14
Start:	44403187
stop:	44409683
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g35440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G09010	AT	Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 4 \| chr4:5777502-5779338 REVERSE LENGTH=349	SoyBase	E_val: 2.00E-156	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009637	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to blue light	SoyBase	N/A	ISS
GO:0010103	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010218	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to far red light	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0019760	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate metabolic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0031977	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen	SoyBase	N/A	ISS
GO:0004601	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peroxidase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF00141	PFAM	Peroxidase	JGI		ISS
UniRef100_C6TBZ8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TBZ8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I6PC02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: APX n=1 Tax=Dimocarpus longan RepID=I6PC02_9ROSI	SoyBase	E_val: 8.00E-170	ISS

Expression Patterns of Glyma14g35440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35440 not represented in the dataset	Glyma14g35440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g35440

Paralog	Evidence	Comments
Glyma02g37160	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g35440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g177200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g35440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma14g35440

Limit To All Plant Sequences

>Glyma14g35440.3   sequence type=transcript   gene model=Glyma14g35440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTTGCACGTCAAGAATCTCAAGATTGCACTAGCTCATCCTTGAAAAAAAGAACATCTCTTCTTCCCATAGCTTCCAGCATTTCATCTTCTATTTTTTAGAGATAATTTTGCAAAATCTTGCACAACTAAGTCTCAGGACAAAGTCCAAGTGAAATCAAAAAAGTCATCAAGTTTTATGTGTGTGTTATTTTCTTCTTTTGTTCCAAGTTTTATGTTATCATCACAGAGTAATTCAATTAGGAAGGCTAACATGTTGCACCATTAGATTTGCCTCGTGCCTCGTGATTAATCCAAATTTTCTACAGTCAACATGGAATCCAGTGGTTCTTCATATTTGTTACCTTCTTTTGTTTCTGTTTTCATATAGCATTGTTCTTTTGAGTATCTAATGCAATATATACTTGTGAATAAGATTAATGTGATGATGAGTTTCGGTCAGTTGTATCTGTTTTTAGGAATTGATTGGAAGCTCCGGATCGCTTGTTGGAATGGCTAATGCTGCTGACTTGATACAGCGCAGACAGCGTTCTGAATTTCAATCTAAGGTTAAGGAAACACTTTTTACAGCCATAAAGGGAAATCCTGATCTTATCCCATCCTTACTGACACTGGCTCTAAATGATGCTTTGACTTATGATAAGGCAACAAAATCGGGTGGTCCAAATGGCTCTATACGGTTCAGGGCTTCTGCTGCCATGAATTTATTAGAGGAAGCAAAAAAGGAAATAGACTCATATTCCAAAGGTGGACCCATTTCCTATGCAGATCTGATCCACTTTGCAGCGCAAAGTGCTGCCAAGGCTACATTTTTAGCTGCTGCCATTCGAAAATGTGGTGGAAATGAGGAGAAAGGGAAAACACTGTACAATGCATACGGATCGAATGGGCAGTGGGGTTTGTTCGATAGGCAATTTGGTAGGGCTGATACTCAAGACCCAGATCCAGAGGGAAGAGTTCCAATATGGGAGAAGGCAAGTGTACAGGAAATGAAAGACAAGTTTGTTGCTGTAGGCTTTGGTCCTCGCCAGCTGGCTGTTTTATCTGCATTCTTAGGTCCTGATCAGACTGCAACAGAGACCTTATTGGCCACTGATCCTGATGTTGCTCCATGGGTTCAGAAATACCAACGGAGCCGTGAAACAGTCTCTCAGACAGATTATGAGGTTGATCTGATAACCACTTTCACAAAACTGAGTACCTTGGGCCAACAAATCAACTATGAGGCATATACATATCCTCCACCAAAGATCGACATTACCAAACTCAAATTGTAA

Coding sequences of Glyma14g35440

Limit To All Plant Sequences

>Glyma14g35440.2   sequence type=CDS   gene model=Glyma14g35440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTCTCCTTCCTCTCGACTTGCCCTTCCCTGCTTCCACTCGTTGCTTATGATACACCACCCTCCACCAGATACCAACCTCGTTCAGTAAGTTTCCACTTTGATCTACTAGTGTCTGTCAACATACAATGTAGTTCCAGTTCACGGATGCTGTTATGTCGCTTTGTGTCCATTTGTTGTAATAAAACCATAAGCAATGTTAGTGATGAAGAGCCGTTCCATTGGAGAAGGAGAGAAATTCTTAAATGCGCTGGGGCAACCGTTGGCTTGGAATTGATTGGAAGCTCCGGATCGCTTGTTGGAATGGCTAATGCTGCTGACTTGATACAGCGCAGACAGCGTTCTGAATTTCAATCTAAGGTTAAGGAAACACTTTTTACAGCCATAAAGGGAAATCCTGATCTTATCCCATCCTTACTGACACTGGCTCTAAATGATGCTTTGACTTATGATAAGGCAACAAAATCGGGTGGTCCAAATGGCTCTATACGGTTCAGGGCTTCTGCTGCCATGAATTTATTAGAGGAAGCAAAAAAGGAAATAGACTCATATTCCAAAGGTGGACCCATTTCCTATGCAGATCTGATCCACTTTGCAGCGCAAAGTGCTGCCAAGGCTACATTTTTAGCTGCTGCCATTCGAAAATGTGGTGGAAATGAGGAGAAAGGGAAAACACTGTACAATGCATACGGATCGAATGGGCAGTGGGGTTTGTTCGATAGGCAATTTGGTAGGGCTGATACTCAAGACCCAGATCCAGAGGGAAGAGTTCCAATATGGGAGAAGGCAAGTGTACAGGAAATGAAAGACAAGTTTGTTGCTGTAGGCTTTGGTCCTCGCCAGCTGGCTGTTTTATCTGCATTCTTAGGTCCTGATCAGACTGCAACAGAGACCTTATTGGCCACTGATCCTGATGTTGCTCCATGGGTTCAGAAATACCAACGGAGCCGTGAAACAGTCTCTCAGACAGATTATGAGGTTGATCTGATAACCACTTTCACAAAACTGAGTACCTTGGGCCAACAAATCAACTATGAGGCATATACATATCCTCCACCAAAGATCGACATTACCAAACTCAAATTGTAA

>Glyma14g35440.3   sequence type=CDS   gene model=Glyma14g35440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAATGCTGCTGACTTGATACAGCGCAGACAGCGTTCTGAATTTCAATCTAAGGTTAAGGAAACACTTTTTACAGCCATAAAGGGAAATCCTGATCTTATCCCATCCTTACTGACACTGGCTCTAAATGATGCTTTGACTTATGATAAGGCAACAAAATCGGGTGGTCCAAATGGCTCTATACGGTTCAGGGCTTCTGCTGCCATGAATTTATTAGAGGAAGCAAAAAAGGAAATAGACTCATATTCCAAAGGTGGACCCATTTCCTATGCAGATCTGATCCACTTTGCAGCGCAAAGTGCTGCCAAGGCTACATTTTTAGCTGCTGCCATTCGAAAATGTGGTGGAAATGAGGAGAAAGGGAAAACACTGTACAATGCATACGGATCGAATGGGCAGTGGGGTTTGTTCGATAGGCAATTTGGTAGGGCTGATACTCAAGACCCAGATCCAGAGGGAAGAGTTCCAATATGGGAGAAGGCAAGTGTACAGGAAATGAAAGACAAGTTTGTTGCTGTAGGCTTTGGTCCTCGCCAGCTGGCTGTTTTATCTGCATTCTTAGGTCCTGATCAGACTGCAACAGAGACCTTATTGGCCACTGATCCTGATGTTGCTCCATGGGTTCAGAAATACCAACGGAGCCGTGAAACAGTCTCTCAGACAGATTATGAGGTTGATCTGATAACCACTTTCACAAAACTGAGTACCTTGGGCCAACAAATCAACTATGAGGCATATACATATCCTCCACCAAAGATCGACATTACCAAACTCAAATTGTAA

Predicted protein sequences of Glyma14g35440

Limit To All Plant Sequences

>Glyma14g35440.2   sequence type=predicted peptide   gene model=Glyma14g35440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVSFLSTCPSLLPLVAYDTPPSTRYQPRSVSFHFDLLVSVNIQCSSSSRMLLCRFVSICCNKTISNVSDEEPFHWRRREILKCAGATVGLELIGSSGSLVGMANAADLIQRRQRSEFQSKVKETLFTAIKGNPDLIPSLLTLALNDALTYDKATKSGGPNGSIRFRASAAMNLLEEAKKEIDSYSKGGPISYADLIHFAAQSAAKATFLAAAIRKCGGNEEKGKTLYNAYGSNGQWGLFDRQFGRADTQDPDPEGRVPIWEKASVQEMKDKFVAVGFGPRQLAVLSAFLGPDQTATETLLATDPDVAPWVQKYQRSRETVSQTDYEVDLITTFTKLSTLGQQINYEAYTYPPPKIDITKLKL*

>Glyma14g35440.3   sequence type=predicted peptide   gene model=Glyma14g35440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANAADLIQRRQRSEFQSKVKETLFTAIKGNPDLIPSLLTLALNDALTYDKATKSGGPNGSIRFRASAAMNLLEEAKKEIDSYSKGGPISYADLIHFAAQSAAKATFLAAAIRKCGGNEEKGKTLYNAYGSNGQWGLFDRQFGRADTQDPDPEGRVPIWEKASVQEMKDKFVAVGFGPRQLAVLSAFLGPDQTATETLLATDPDVAPWVQKYQRSRETVSQTDYEVDLITTFTKLSTLGQQINYEAYTYPPPKIDITKLKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain