SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35323): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35323): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35323

Feature Type:gene_model
Chromosome:Gm14
Start:44215209
stop:44215893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52910AT Annotation by Michelle Graham. TAIR10: timeless family protein | chr5:21457774-21463159 REVERSE LENGTH=1141 SoyBaseE_val: 1.00E-27ISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PTHR22940Panther TIMEOUT/TIMELESS-2 JGI ISS
PTHR22940:SF4Panther gb def: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MXC20 JGI ISS
PF05029PFAM Timeless protein C terminal region JGI ISS
UniRef100_G7IDV7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Topoisomerase 1-associated factor n=1 Tax=Medicago truncatula RepID=G7IDV7_MEDTR SoyBaseE_val: 3.00E-46ISS
UniRef100_I1NGZ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NGZ9_SOYBN SoyBaseE_val: 7.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35323 not represented in the dataset

Glyma14g35323 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g176200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g35323.1   sequence type=CDS   gene model=Glyma14g35323   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAAAGAAAATGAAAAAGCAACCCCTCTTGTTTGTGGAACTCCTTTTCTGGAAGACTCGGATGGAATGCCATTACATCAATGCTGAATATTTGTTGAGCGAGCTTGGTCATTTGAAGAAAGAAAGTGCCAATTGGAATAACACTCAGGGAGATGAAGAAATTGGTTCATCCCCAGCAAAGGTAGACAAGCTTGATGTTATTAAAGGCTTTGCACCTACCTCTGGCAGTAACAGTGACAAAGATGATCATAATGGGGAGCAATTGATGGAAGATGAATCTCAAATTGCTCTAAGGAGAAGGAAGAAACTTGTTCTTGATGGTGATTTGGAAAGACAAATCAAAGATCTCCATGAGAAGTAG

>Glyma14g35323.1   sequence type=predicted peptide   gene model=Glyma14g35323   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKKMKKQPLLFVELLFWKTRMECHYINAEYLLSELGHLKKESANWNNTQGDEEIGSSPAKVDKLDVIKGFAPTSGSNSDKDDHNGEQLMEDESQIALRRRKKLVLDGDLERQIKDLHEK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo