Glyma14g35310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35310

Feature Type:	gene_model
Chromosome:	Gm14
Start:	44191784
stop:	44193531
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g35310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G60640	AT	Annotation by Michelle Graham. TAIR10: PDI-like 1-4 \| chr5:24371416-24373993 REVERSE LENGTH=536	SoyBase	E_val: 3.00E-32	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0006662	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003756	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
GO:0016853	GO-mf	Annotation by Michelle Graham. GO Molecular Function: isomerase activity	SoyBase	N/A	ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
UniRef100_G7JPD1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase L-2 n=1 Tax=Medicago truncatula RepID=G7JPD1_MEDTR	SoyBase	E_val: 1.00E-34	ISS
UniRef100_UPI000233C6BF	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C6BF related cluster n=1 Tax=unknown RepID=UPI000233C6BF	SoyBase	E_val: 2.00E-43	ISS

Expression Patterns of Glyma14g35310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35310 not represented in the dataset	Glyma14g35310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g35310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g35310

Limit To All Plant Sequences

>Glyma14g35310.1   sequence type=CDS   gene model=Glyma14g35310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTCATTTCTCTTTCGCCACTCTCCTTCTCTTCTCATCCCTCTCCCTCACTCTCTGCAATAAAAACGACAACCAAAAAAGCAACAACGATGACATTAAAGATCTCAACTTCCTCGAGGAACCCGATGACGTCGTTGCCACTTCTCACTACAACCATTTTCCAGATCCCAACCAGTTCGACAAGGATGGTGACAACGATGAGGACAAGTTCAGTGACTTCGCTGGCTTCGACCACTCGTTAGAGGAGGCGTTTAAAGAGTCCAAGGTGGACGACAAGGACGTCATCATTTTCAAGAAGCACAACTTCACCATCGCCGTAAAAAACAACTGCTTCGTCATGGTCAAGCTCTACGTGCCCTGGTGCAGCCACTACCAGGCCCTCACGCCAAAGTACACCGTCGCCACCACCGAGCTCAAGCCCAACAGCGTCATTCTCACCAAGGTCAACGCTACTGTCGAAAAAAATTGGCGAGCGAGTACGATGTTCATGGTTTCCCCACCGTCTTCTTCTTCATCAATGGGGTTCACAAGCCCTACACTGGCCAAAGAACCAAACGCTATAATGACATGGATTAAGAAGAAGATAGGACCTGGTGTGTCCAACATTACTACGGTGGAAGAAGCTAAACGTATATTGACCGCGAAAAGAAAAGTAATTCTTGTTAAAGTCAACAAACTTACTCTACATGCATGTTTATCCGGTAATACACTACTTCAATTCTTAATCTATCGGTGTAATATAAGGGTCAGCTTGTTATGTCTAATTTTACACCCTTTTTTTTTGGAAATTTTATCATATCATTCACAACTTTCACATTGTAAGTTATTGTTGAATTCAATAAATAACACTTGTTCACTTGTTTATGATCTGTTTCTACAT

Predicted protein sequences of Glyma14g35310

Limit To All Plant Sequences

>Glyma14g35310.1   sequence type=predicted peptide   gene model=Glyma14g35310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IHFSFATLLLFSSLSLTLCNKNDNQKSNNDDIKDLNFLEEPDDVVATSHYNHFPDPNQFDKDGDNDEDKFSDFAGFDHSLEEAFKESKVDDKDVIIFKKHNFTIAVKNNCFVMVKLYVPWCSHYQALTPKYTVATTELKPNSVILTKVNATVEKNWRASTMFMVSPPSSSSSMGFTSPTLAKEPNAIMTWIKKKIGPGVSNITTVEEAKRILTAKRKVILVKVNKLTLHACLSGNTLLQFLIYRCNIRVSLLCLILHPFFLEILSYHSQLSHCKLLLNSINNTCSLVYDLFLH

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain