SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g35310

Feature Type:gene_model
Chromosome:Gm14
Start:44191784
stop:44193531
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g35310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60640AT Annotation by Michelle Graham. TAIR10: PDI-like 1-4 | chr5:24371416-24373993 REVERSE LENGTH=536 SoyBaseE_val: 3.00E-32ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0016853GO-mf Annotation by Michelle Graham. GO Molecular Function: isomerase activity SoyBaseN/AISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_G7JPD1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase L-2 n=1 Tax=Medicago truncatula RepID=G7JPD1_MEDTR SoyBaseE_val: 1.00E-34ISS
UniRef100_UPI000233C6BFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C6BF related cluster n=1 Tax=unknown RepID=UPI000233C6BF SoyBaseE_val: 2.00E-43ISS

Expression Patterns of Glyma14g35310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g35310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g35310
>Glyma14g35310.1   sequence type=CDS   gene model=Glyma14g35310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTCATTTCTCTTTCGCCACTCTCCTTCTCTTCTCATCCCTCTCCCTCACTCTCTGCAATAAAAACGACAACCAAAAAAGCAACAACGATGACATTAAAGATCTCAACTTCCTCGAGGAACCCGATGACGTCGTTGCCACTTCTCACTACAACCATTTTCCAGATCCCAACCAGTTCGACAAGGATGGTGACAACGATGAGGACAAGTTCAGTGACTTCGCTGGCTTCGACCACTCGTTAGAGGAGGCGTTTAAAGAGTCCAAGGTGGACGACAAGGACGTCATCATTTTCAAGAAGCACAACTTCACCATCGCCGTAAAAAACAACTGCTTCGTCATGGTCAAGCTCTACGTGCCCTGGTGCAGCCACTACCAGGCCCTCACGCCAAAGTACACCGTCGCCACCACCGAGCTCAAGCCCAACAGCGTCATTCTCACCAAGGTCAACGCTACTGTCGAAAAAAATTGGCGAGCGAGTACGATGTTCATGGTTTCCCCACCGTCTTCTTCTTCATCAATGGGGTTCACAAGCCCTACACTGGCCAAAGAACCAAACGCTATAATGACATGGATTAAGAAGAAGATAGGACCTGGTGTGTCCAACATTACTACGGTGGAAGAAGCTAAACGTATATTGACCGCGAAAAGAAAAGTAATTCTTGTTAAAGTCAACAAACTTACTCTACATGCATGTTTATCCGGTAATACACTACTTCAATTCTTAATCTATCGGTGTAATATAAGGGTCAGCTTGTTATGTCTAATTTTACACCCTTTTTTTTTGGAAATTTTATCATATCATTCACAACTTTCACATTGTAAGTTATTGTTGAATTCAATAAATAACACTTGTTCACTTGTTTATGATCTGTTTCTACAT
Predicted protein sequences of Glyma14g35310
>Glyma14g35310.1   sequence type=predicted peptide   gene model=Glyma14g35310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IHFSFATLLLFSSLSLTLCNKNDNQKSNNDDIKDLNFLEEPDDVVATSHYNHFPDPNQFDKDGDNDEDKFSDFAGFDHSLEEAFKESKVDDKDVIIFKKHNFTIAVKNNCFVMVKLYVPWCSHYQALTPKYTVATTELKPNSVILTKVNATVEKNWRASTMFMVSPPSSSSSMGFTSPTLAKEPNAIMTWIKKKIGPGVSNITTVEEAKRILTAKRKVILVKVNKLTLHACLSGNTLLQFLIYRCNIRVSLLCLILHPFFLEILSYHSQLSHCKLLLNSINNTCSLVYDLFLH






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo