Glyma14g35260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g35260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g35260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g35260

Feature Type:	gene_model
Chromosome:	Gm14
Start:	44157718
stop:	44159530
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g35260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G53760	AT	Annotation by Michelle Graham. TAIR10: GAMMA-TUBULIN COMPLEX PROTEIN 4 \| chr3:19918182-19922264 REVERSE LENGTH=745	SoyBase	E_val: 7.00E-75	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0007020	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule nucleation	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0016570	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone modification	SoyBase	N/A	ISS
GO:0040007	GO-bp	Annotation by Michelle Graham. GO Biological Process: growth	SoyBase	N/A	ISS
GO:0043622	GO-bp	Annotation by Michelle Graham. GO Biological Process: cortical microtubule organization	SoyBase	N/A	ISS
GO:0048449	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ formation	SoyBase	N/A	ISS
GO:0000922	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: spindle pole	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005815	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: microtubule organizing center	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0045298	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: tubulin complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0015631	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tubulin binding	SoyBase	N/A	ISS
PTHR19302	Panther	GAMMA TUBULIN COMPLEX PROTEIN	JGI		ISS
PTHR19302:SF10	Panther	GAMMA-TUBULIN RING PROTEIN DGRIP84	JGI		ISS
PF04130	PFAM	Spc97 / Spc98 family	JGI		ISS
UniRef100_B9SAS5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gamma-tubulin complex component, putative n=1 Tax=Ricinus communis RepID=B9SAS5_RICCO	SoyBase	E_val: 6.00E-73	ISS
UniRef100_D7U2A6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7U2A6_VITVI	SoyBase	E_val: 1.00E-75	ISS

Expression Patterns of Glyma14g35260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35260 not represented in the dataset	Glyma14g35260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g175700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g35260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g35260

Limit To All Plant Sequences

>Glyma14g35260.1   sequence type=CDS   gene model=Glyma14g35260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCGACTTAGAGAACATATGGCATTCTTGGTCAGAAATCTCCAATTTTATAGTCAGATTTATGTGATAGAGTTTCAATGGAATATTTTGCAATCTCATATTCAAGAGTCTCATGATTTTACAGAACTTGTGGGCTTTCATCAAGAGTATCAGTCAGCCTTGATTTCACAAACTTTCTTGGACATTGGTTCTGGGTCGAGGATACTGGAAAGTATCATGAAGCTTTGCTTGCAATTTTGCTGGAATATTGAGAACCAAGATAATTTTTCAAATACTTATGAACTGAAGCATATAGTTGACGAATTCAACAAGAAATCAAATTTCTTGTCCACTATACTGCGTAGTAGTAGGCTTGCTGGAAGTCAGCGGGCACCCTTTTTGAGACGTTTTCTCTTGCGGTTAAATCTGAATTCCTTCTTTGAGGTAATGTGTATATGTGTTGTTTATATTCAATGCAGAAGGACACCAGTACCACTGCCCCATCAACTACAAGTGGTCAGGTTAGGCACCAAAAACACTTAA

Predicted protein sequences of Glyma14g35260

Limit To All Plant Sequences

>Glyma14g35260.1   sequence type=predicted peptide   gene model=Glyma14g35260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWRLREHMAFLVRNLQFYSQIYVIEFQWNILQSHIQESHDFTELVGFHQEYQSALISQTFLDIGSGSRILESIMKLCLQFCWNIENQDNFSNTYELKHIVDEFNKKSNFLSTILRSSRLAGSQRAPFLRRFLLRLNLNSFFEVMCICVVYIQCRRTPVPLPHQLQVVRLGTKNT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain