Report for Sequence Feature Glyma14g35230
Feature Type: gene_model
Chromosome: Gm14
Start: 44079033
stop: 44079292
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g35230
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G09860 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 34 Blast hits to 34 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3026140-3027000 FORWARD LENGTH=98
SoyBase E_val: 2.00E-13 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_UPI000233BDE7 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233BDE7 related cluster n=1 Tax=unknown RepID=UPI000233BDE7
SoyBase E_val: 2.00E-27 ISS
Expression Patterns of Glyma14g35230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma14g35230 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.14g175600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma14g35230
Coding sequences of Glyma14g35230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g35230.1 sequence type=CDS gene model=Glyma14g35230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TGGCATGACAAAGCAATGCTATATGAGCAATGTCCCTGGAAACAGGCAAGGAAGAAGAATCAACCATATGAGTTCATGTGGAACAAGACTTGGGACAAGAACCACCGGGAACATTACTACTACAACTGGCCTATTTACTTTCCTTAG
Predicted protein sequences of Glyma14g35230
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g35230.1 sequence type=predicted peptide gene model=Glyma14g35230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
WHDKAMLYEQCPWKQARKKNQPYEFMWNKTWDKNHREHYYYNWPIYFP*