|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G27740 | AT | Annotation by Michelle Graham. TAIR10: ATPase family associated with various cellular activities (AAA) | chr5:9823831-9826869 FORWARD LENGTH=354 | SoyBase | E_val: 7.00E-10 | ISS |
GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
GO:0006261 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication | SoyBase | N/A | ISS |
GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
PF10424 | PFAM | Clamp-loader complex subunit E C-terminus | JGI | ISS | |
UniRef100_B9S6E2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Replication factor C / DNA polymerase III gamma-tau subunit, putative n=1 Tax=Ricinus communis RepID=B9S6E2_RICCO | SoyBase | E_val: 3.00E-25 | ISS |
UniRef100_UPI000233D2BD | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D2BD related cluster n=1 Tax=unknown RepID=UPI000233D2BD | SoyBase | E_val: 1.00E-40 | ISS |
Glyma14g35205 not represented in the dataset |
Glyma14g35205 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g175300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g35205.1 sequence type=CDS gene model=Glyma14g35205 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTTCTGTTTGATTTTGTCCACCCAAAATTGATTCTCCAGAAACTCGTGGAACATCTCCTAAAAAGAATTGAGGCTAGCTTAAGAAGGGAGCTTTACTACTGGCATGCTTATTATGACAGAAGACTCCCACCAAGAATAACAGCTTTACTAAAGTTAGAAGAATTTGTGGCCAAGTTCATGAGCATGTGTAGAAAAAACTTTGGCAATCGGAAATATGTGTAG
>Glyma14g35205.1 sequence type=predicted peptide gene model=Glyma14g35205 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLLFDFVHPKLILQKLVEHLLKRIEASLRRELYYWHAYYDRRLPPRITALLKLEEFVAKFMSMCRKNFGNRKYV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||