SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g35205

Feature Type:gene_model
Chromosome:Gm14
Start:44037357
stop:44038018
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g35205
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27740AT Annotation by Michelle Graham. TAIR10: ATPase family associated with various cellular activities (AAA) | chr5:9823831-9826869 FORWARD LENGTH=354 SoyBaseE_val: 7.00E-10ISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PF10424PFAM Clamp-loader complex subunit E C-terminus JGI ISS
UniRef100_B9S6E2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Replication factor C / DNA polymerase III gamma-tau subunit, putative n=1 Tax=Ricinus communis RepID=B9S6E2_RICCO SoyBaseE_val: 3.00E-25ISS
UniRef100_UPI000233D2BDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D2BD related cluster n=1 Tax=unknown RepID=UPI000233D2BD SoyBaseE_val: 1.00E-40ISS

Expression Patterns of Glyma14g35205
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g35205 not represented in the dataset
Glyma14g35205 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g35205 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g175300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g35205
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g35205
>Glyma14g35205.1   sequence type=CDS   gene model=Glyma14g35205   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTCTGTTTGATTTTGTCCACCCAAAATTGATTCTCCAGAAACTCGTGGAACATCTCCTAAAAAGAATTGAGGCTAGCTTAAGAAGGGAGCTTTACTACTGGCATGCTTATTATGACAGAAGACTCCCACCAAGAATAACAGCTTTACTAAAGTTAGAAGAATTTGTGGCCAAGTTCATGAGCATGTGTAGAAAAAACTTTGGCAATCGGAAATATGTGTAG
Predicted protein sequences of Glyma14g35205
>Glyma14g35205.1   sequence type=predicted peptide   gene model=Glyma14g35205   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLFDFVHPKLILQKLVEHLLKRIEASLRRELYYWHAYYDRRLPPRITALLKLEEFVAKFMSMCRKNFGNRKYV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo