Glyma14g34990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34990

Feature Type:	gene_model
Chromosome:	Gm14
Start:	43688689
stop:	43690788
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g34990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21870	AT	Annotation by Michelle Graham. TAIR10: copper ion binding;cobalt ion binding;zinc ion binding \| chr2:9320612-9322618 REVERSE LENGTH=220	SoyBase	E_val: 1.00E-103	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005753	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
UniRef100_I1MAU1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAU1_SOYBN	SoyBase	E_val: 7.00E-144	ISS
UniRef100_Q9SJ12	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Probable ATP synthase 24 kDa subunit, mitochondrial n=2 Tax=Arabidopsis thaliana RepID=ATP7_ARATH	SoyBase	E_val: 2.00E-100	ISS

Expression Patterns of Glyma14g34990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34990 not represented in the dataset	Glyma14g34990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g34990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g34990

Limit To All Plant Sequences

>Glyma14g34990.1   sequence type=CDS   gene model=Glyma14g34990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTGTGGTTTATCCACTTTTTTTTTGTCATGTGCTCATTTTTCTTCATTTTTCTTACAGATCTATGGCAGTCAAATACTTCTACAAAAGGAGCATGCTATTCCAGTTCGTCACTTTGCTAAAGAGTCTGCCCCTCCTGCCCTTAAGGGAGACGAGATGCTGAAGAACATTTTTGTGGAGGTGAAGAACAAATTTGAGACCGCCATAGGAATATTAAAGAAGGAGAAAATCACCATTGACCCAGAAGATCCAGCTGTTGTTTCTCATTATGCAAAGGTCATGAAAACAATTAGAGAGAAGGCAAGCTTATTGCCGGAGTCCCAAGACATACTATCCACCATTGAAATTGAGACACAGGATATTCCAGATGCTCGGACCTATCTTCTGACTTTGAAGGAAATAAGAGTCAAGAGAGGTCTTACAGATGATCTTGGTGCAGAGGCTCTGATGATAGATGCATTGGACAAAGTTGAAAAGGATTTAAAAAAACCTTTACTGAGAAATGATAAGAAAGGAATGGACCTTCTCTTGGCAGAGTTTGATAAGATTAATAAGAAACTTGGAATTCGAAAGGAAGATCTACCGAAGTATGAAGAGGAGCTAGAACTTAAAGTAGCCAAAGCACAACTGGAGGAGCTGAAGAAGGATGCTCTTGAGGCAATGGAAACTCAAAAGAAGAGGTACTACTAA

Predicted protein sequences of Glyma14g34990

Limit To All Plant Sequences

>Glyma14g34990.1   sequence type=predicted peptide   gene model=Glyma14g34990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSCGLSTFFLSCAHFSSFFLQIYGSQILLQKEHAIPVRHFAKESAPPALKGDEMLKNIFVEVKNKFETAIGILKKEKITIDPEDPAVVSHYAKVMKTIREKASLLPESQDILSTIEIETQDIPDARTYLLTLKEIRVKRGLTDDLGAEALMIDALDKVEKDLKKPLLRNDKKGMDLLLAEFDKINKKLGIRKEDLPKYEEELELKVAKAQLEELKKDALEAMETQKKRYY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain