Glyma14g34961 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34961): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34961): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34961

Feature Type:	gene_model
Chromosome:	Gm14
Start:	43672804
stop:	43673417
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g34961

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18800	AT	Annotation by Michelle Graham. TAIR10: NAP1-related protein 2 \| chr1:6481466-6483463 REVERSE LENGTH=256	SoyBase	E_val: 2.00E-37	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0010311	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root formation	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003682	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chromatin binding	SoyBase	N/A	ISS
GO:0042393	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histone binding	SoyBase	N/A	ISS
PTHR11875	Panther	NUCLEOSOME ASSEMBLY PROTEIN	JGI		ISS
PTHR11875:SF47	Panther		JGI		ISS
PF00956	PFAM	Nucleosome assembly protein (NAP)	JGI		ISS
UniRef100_B9IJV5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleosome/chromatin assembly factor group (Fragment) n=1 Tax=Populus trichocarpa RepID=B9IJV5_POPTR	SoyBase	E_val: 5.00E-35	ISS
UniRef100_UPI00023395C3	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023395C3 related cluster n=1 Tax=unknown RepID=UPI00023395C3	SoyBase	E_val: 7.00E-43	ISS

Expression Patterns of Glyma14g34961

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34961 not represented in the dataset	Glyma14g34961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34961 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g173800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g34961

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g34961

Limit To All Plant Sequences

>Glyma14g34961.1   sequence type=CDS   gene model=Glyma14g34961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAAGAAGGGCGAAAAAACTTGATGAAGTCGACGGAGAACTCGTCCTCTCTATTGAAAAGTTGCAGGAGATCCAAGATGAGCTTGAAAAGATCAATGAGAAAACCAATGACAAAGTGCTCGAAATAGGGCAGAAGTACAATGAGATACGGAAGCCCGTCTATGATAAGAGGAATGATATTATCAAGGCTATCTCCGAATTTTGGTTAACTGCTTTTTTGAGCCATCCTGCTCTTGGTGATCTTTTGAACGAGGAAGATTAG

Predicted protein sequences of Glyma14g34961

Limit To All Plant Sequences

>Glyma14g34961.1   sequence type=predicted peptide   gene model=Glyma14g34961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPRRAKKLDEVDGELVLSIEKLQEIQDELEKINEKTNDKVLEIGQKYNEIRKPVYDKRNDIIKAISEFWLTAFLSHPALGDLLNEED*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain