Glyma14g34920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34920

Feature Type:	gene_model
Chromosome:	Gm14
Start:	43642958
stop:	43643660
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g34920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G55020	AT	Annotation by Michelle Graham. TAIR10: lipoxygenase 1 \| chr1:20525798-20530143 FORWARD LENGTH=859	SoyBase	E_val: 6.00E-43	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0010311	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root formation	SoyBase	N/A	ISS
GO:0030397	GO-bp	Annotation by Michelle Graham. GO Biological Process: membrane disassembly	SoyBase	N/A	ISS
GO:0034440	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid oxidation	SoyBase	N/A	ISS
GO:0040007	GO-bp	Annotation by Michelle Graham. GO Biological Process: growth	SoyBase	N/A	ISS
GO:0048364	GO-bp	Annotation by Michelle Graham. GO Biological Process: root development	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0016165	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipoxygenase activity	SoyBase	N/A	ISS
PTHR11771	Panther	LIPOXYGENASE	JGI		ISS
PTHR11771:SF2	Panther	LIPOXYGENASE	JGI		ISS
PF00305	PFAM	Lipoxygenase	JGI		ISS
UniRef100_Q43446	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lipoxygenase n=2 Tax=Glycine max RepID=Q43446_SOYBN	SoyBase	E_val: 3.00E-79	ISS
UniRef100_UPI000233EBEF	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EBEF related cluster n=1 Tax=unknown RepID=UPI000233EBEF	SoyBase	E_val: 3.00E-84	ISS

Expression Patterns of Glyma14g34920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34920 not represented in the dataset	Glyma14g34920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g34920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g34920

Limit To All Plant Sequences

>Glyma14g34920.1   sequence type=CDS   gene model=Glyma14g34920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GACTATCCTTATGCTTCTGATGGGCTAGAGATATGGGATGCTATCAAGTCTAGGGTGGAAGAATATAGATGCAAACTCGTGAAGAGTTGGTTGAAGCTTCCGCTACCCTCATATGGATTGCTTCAGCTCTTCATGCTGCTGTTAACTTTGGGCAGCCAACTATTAGCAGGAGATTCATGCCTGAGAAAAGGGTCTCCTGAATATGATGCGTTGGCTAAGAACCCTGAGAAGGAGTTTTTGAAGACTATTACAAGCAAGAAAGAGACCCTCATTGACCTTACAGTTATAGAAATTTTATCAAGGCACACATCTGATGAGTTCTACCTTGGGCAGAGAGATGGTGGTGACTACTGGACTTCTGATGCCGGGCCATTAGAGGCCTTTAAGAGGTTTGGAAACAATCTTGAAGAGATTGAAAAGAAGCTTATAGAGAAGAACAATGATGAGACATTGAGAAACCGCTATGGGCCGGCTAAAATGCCTTACACTTTGCTTTATCCTTCTAGTGAGGAGGGATTGACTTTCAGAGGAATTCCCAAAAGTATCTCTATCTAA

Predicted protein sequences of Glyma14g34920

Limit To All Plant Sequences

>Glyma14g34920.1   sequence type=predicted peptide   gene model=Glyma14g34920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DYPYASDGLEIWDAIKSRVEEYRCKLVKSWLKLPLPSYGLLQLFMLLLTLGSQLLAGDSCLRKGSPEYDALAKNPEKEFLKTITSKKETLIDLTVIEILSRHTSDEFYLGQRDGGDYWTSDAGPLEAFKRFGNNLEEIEKKLIEKNNDETLRNRYGPAKMPYTLLYPSSEEGLTFRGIPKSISI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain