SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g34700

Feature Type:gene_model
Chromosome:Gm14
Start:43374244
stop:43376117
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g34700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32490AT Annotation by Michelle Graham. TAIR10: RNA helicase family protein | chr1:11742356-11749286 REVERSE LENGTH=1034 SoyBaseE_val: 7.00E-32ISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0008380GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0035194GO-bp Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing by RNA SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004004GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent RNA helicase activity SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
PTHR25888Panther FAMILY NOT NAMED JGI ISS
PF07717PFAM Domain of unknown function (DUF1605) JGI ISS
UniRef100_F4IE90UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 n=1 Tax=Arabidopsis thaliana RepID=F4IE90_ARATH SoyBaseE_val: 3.00E-29ISS
UniRef100_I1JWQ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWQ1_SOYBN SoyBaseE_val: 4.00E-37ISS

Expression Patterns of Glyma14g34700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g34700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g34700
>Glyma14g34700.1   sequence type=CDS   gene model=Glyma14g34700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCAATTTTCAAGAAAATTTTCCAACATAATTTTGACACCAAAGTCAAACATAATAATGCTAGGAAGTCCTACATCGCCGGCGCAATTTGAAAAGAGAATCAAACAACTTTATGTTGCATTTAGGTGCATTGGACTGATATTGGTTCTTCCCAGATGGGTTGTATACCATGAACTAGTACTCACAACCAAGGAGTATATGAGACAGGTGACGGAGTTGAAGCCAGAGTGGTTGGTGGAGATAGCCCCCCACTATTACCAGCTTAAGGATGTTGAAGACTCATATTCGAAGAAAATGCCTCGTGGAGCAGGACTTGCATCGTAG
Predicted protein sequences of Glyma14g34700
>Glyma14g34700.1   sequence type=predicted peptide   gene model=Glyma14g34700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FQFSRKFSNIILTPKSNIIMLGSPTSPAQFEKRIKQLYVAFRCIGLILVLPRWVVYHELVLTTKEYMRQVTELKPEWLVEIAPHYYQLKDVEDSYSKKMPRGAGLAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo