|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G32490 | AT | Annotation by Michelle Graham. TAIR10: RNA helicase family protein | chr1:11742356-11749286 REVERSE LENGTH=1034 | SoyBase | E_val: 7.00E-32 | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0008380 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA splicing | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0035194 | GO-bp | Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0004004 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent RNA helicase activity | SoyBase | N/A | ISS |
| GO:0004386 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: helicase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008026 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity | SoyBase | N/A | ISS |
| PTHR25888 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PF07717 | PFAM | Domain of unknown function (DUF1605) | JGI | ISS | |
| UniRef100_F4IE90 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 n=1 Tax=Arabidopsis thaliana RepID=F4IE90_ARATH | SoyBase | E_val: 3.00E-29 | ISS |
| UniRef100_I1JWQ1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWQ1_SOYBN | SoyBase | E_val: 4.00E-37 | ISS |
|
Glyma14g34700 not represented in the dataset |
Glyma14g34700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g34700.1 sequence type=CDS gene model=Glyma14g34700 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TTTCAATTTTCAAGAAAATTTTCCAACATAATTTTGACACCAAAGTCAAACATAATAATGCTAGGAAGTCCTACATCGCCGGCGCAATTTGAAAAGAGAATCAAACAACTTTATGTTGCATTTAGGTGCATTGGACTGATATTGGTTCTTCCCAGATGGGTTGTATACCATGAACTAGTACTCACAACCAAGGAGTATATGAGACAGGTGACGGAGTTGAAGCCAGAGTGGTTGGTGGAGATAGCCCCCCACTATTACCAGCTTAAGGATGTTGAAGACTCATATTCGAAGAAAATGCCTCGTGGAGCAGGACTTGCATCGTAG
>Glyma14g34700.1 sequence type=predicted peptide gene model=Glyma14g34700 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high FQFSRKFSNIILTPKSNIIMLGSPTSPAQFEKRIKQLYVAFRCIGLILVLPRWVVYHELVLTTKEYMRQVTELKPEWLVEIAPHYYQLKDVEDSYSKKMPRGAGLAS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||