SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g34651): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g34651): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g34651

Feature Type:gene_model
Chromosome:Gm14
Start:43316932
stop:43317190
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g34651
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G25500AT Annotation by Michelle Graham. TAIR10: Plasma-membrane choline transporter family protein | chr1:8955437-8957294 REVERSE LENGTH=430 SoyBaseE_val: 7.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR12385Panther CTL TRANSPORTER JGI ISS
PTHR12385:SF4Panther gb def: agcp5661 [anopheles gambiae str. pest] JGI ISS
PF04515PFAM Plasma-membrane choline transporter JGI ISS
UniRef100_G7ZZC7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Choline transporter-like protein n=1 Tax=Medicago truncatula RepID=G7ZZC7_MEDTR SoyBaseE_val: 1.00E-34ISS
UniRef100_I1NFG6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NFG6_SOYBN SoyBaseE_val: 4.00E-38ISS

Expression Patterns of Glyma14g34651
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g34651 not represented in the dataset
Glyma14g34651 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g34651 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g171900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g34651
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g34651
>Glyma14g34651.1   sequence type=CDS   gene model=Glyma14g34651   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTTATTTTGGACAGGTGCAGTACTATGTAATATTGTGCATGTTGTAGTGTCTGGGATGGTGTTTCTTGTACTTTTTCATGGTGGTAGAGATGGAACTTCTATTACAGCTAACTCCTTAATGAAATCTCTACAATATGCTTTAACAACATCTTTTGGCAGCATTTGTTATGGTTCATTATTTACTGTAGCTATTAGGACACTACGGTGGGAGCGAGGTAACCAATCATTATGGCCAATTTGA
Predicted protein sequences of Glyma14g34651
>Glyma14g34651.1   sequence type=predicted peptide   gene model=Glyma14g34651   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFWTGAVLCNIVHVVVSGMVFLVLFHGGRDGTSITANSLMKSLQYALTTSFGSICYGSLFTVAIRTLRWERGNQSLWPI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo